2. Recombinant Proteins
  3. Others
  4. P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His)

P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His)

Cat. No.: HY-P702413
Handling Instructions

The P30 adhesin, vital for cytadherence and virulence, mediates crucial cell interactions, facilitating adherence processes integral to pathogenicity. Its role emphasizes its contribution to the overall virulence mechanism, underscoring its importance in the pathogenic lifecycle. P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His) is the recombinant P30 adhesin protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His) is 274 a.a., with molecular weight of 32.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The P30 adhesin, vital for cytadherence and virulence, mediates crucial cell interactions, facilitating adherence processes integral to pathogenicity. Its role emphasizes its contribution to the overall virulence mechanism, underscoring its importance in the pathogenic lifecycle. P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His) is the recombinant P30 adhesin protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His) is 274 a.a., with molecular weight of 32.6 kDa.
Background

The P30 adhesin is an essential component crucial for achieving successful cytadherence and promoting virulence. This protein plays a pivotal role in mediating interactions between cells, facilitating adherence processes that are integral to the pathogenicity of the organism. Its significance lies in its ability to contribute to the overall virulence mechanism, highlighting the importance of the P30 adhesin in the pathogenic lifecycle.
Species

Others
Source

E. coli Cell-free
Tag

N-10*His
Accession

P75330 (M1-R274)
Gene ID

/
Molecular Construction
N-term
10*His
P30 adhesin (M1-R274)
Accession # P75330
C-term
Synonyms
P30 adhesin; 30 kDa adhesin-related protein; Cytadhesin P30
AA Sequence

MKLPPRRKLKLFLLAWMLVLFSALIVLATLILVQHNNTELTEVKSELSPLNVVLHAEEDTVQIQGKPITEQAWFIPTVAGCFGFSALAIILGLAIGLPIVKRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR

Molecular Weight

32.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
P30 adhesin Protein, Mycoplasma pneumoniae (Cell-Free, His)
Cat. No.:
HY-P702413
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.