1. Recombinant Proteins
  2. Others
  3. Pal Protein, Legionella pneumophila (His-SUMO)

Pal Protein, Legionella pneumophila (His-SUMO)

Cat. No.: HY-P71467
COA Handling Instructions

Pal protein, part of the Tol-Pal system, is pivotal in outer membrane invagination and maintenance of integrity during cell division. Integrated with TolA, TolQ, TolR, and TolB, the system connects inner and outer membranes to the peptidoglycan layer. Pal's strong association with peptidoglycan underscores its crucial role in the structural and functional dynamics of the Tol-Pal system. Pal Protein, Legionella pneumophila (His-SUMO) is the recombinant Pal protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Pal Protein, Legionella pneumophila (His-SUMO) is 155 a.a., with molecular weight (affected by relative charge) of ~36 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $130 In-stock
10 μg $220 In-stock
50 μg $620 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pal protein, part of the Tol-Pal system, is pivotal in outer membrane invagination and maintenance of integrity during cell division. Integrated with TolA, TolQ, TolR, and TolB, the system connects inner and outer membranes to the peptidoglycan layer. Pal's strong association with peptidoglycan underscores its crucial role in the structural and functional dynamics of the Tol-Pal system. Pal Protein, Legionella pneumophila (His-SUMO) is the recombinant Pal protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Pal Protein, Legionella pneumophila (His-SUMO) is 155 a.a., with molecular weight (affected by relative charge) of ~36 kDa.

Background

Pal protein is an integral component of the Tol-Pal system, contributing to outer membrane invagination during cell division and playing a crucial role in maintaining outer membrane integrity. This system, comprised of five core proteins—TolA, TolQ, TolR in the inner membrane, TolB in the periplasm, and Pal in the outer membrane—forms a sophisticated network that connects the inner and outer membranes to the peptidoglycan layer. Pal protein, in particular, exhibits a robust association with the peptidoglycan, highlighting its significance in the structural and functional interplay within the Tol-Pal system.

Species

Others

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P26493 (C22-R176)

Gene ID

57036037

Molecular Construction
N-term
6*His-SUMO
Pal (C22-R176)
Accession # P26493
C-term
Synonyms
pal; pplA; Peptidoglycan-associated lipoprotein; PAL; 19kDa surface antigen; PPL
AA Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Molecular Weight

Approximately 36 kDa, The reducing (R) protein migrates as 36 kDa in SDS-PAGE may be due to relative charge.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Pal Protein, Legionella pneumophila (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pal Protein, Legionella pneumophila (His-SUMO)
Cat. No.:
HY-P71467
Quantity:
MCE Japan Authorized Agent: