PEX19 Protein, Human (GST)

PEX19 protein is pivotal in early peroxisomal biogenesis, acting as a cytosolic chaperone and import receptor for peroxisomal membrane proteins (PMPs). It binds to and stabilizes newly synthesized PMPs in the cytoplasm, particularly their hydrophobic domains. PEX19 targets PMPs to the peroxisome membrane by associating with integral membrane protein PEX3. Engaging in diverse interactions with peroxisomal membrane proteins and other components, PEX19 facilitates peroxisomal assembly. Additionally, it contributes to nuclear exclusion of CDKN2A, preventing TP53 degradation by MDM2 and interacting with tumor suppressor CDKN2A/p19ARF in intricate cellular processes. PEX19 Protein, Human (GST) is the recombinant human-derived PEX19 protein, expressed by E. coli, with N-GST labeled tag. The total length of PEX19 Protein, Human (GST) is 295 a.a., with molecular weight of 59.3 kDa.

PEX19 protein plays a crucial role in early peroxisomal biogenesis, serving both as a cytosolic chaperone and an import receptor for peroxisomal membrane proteins (PMPs). Its function involves binding to and stabilizing newly synthesized PMPs in the cytoplasm, particularly through interactions with their hydrophobic membrane-spanning domains. Subsequently, PEX19 targets these PMPs to the peroxisome membrane by associating with the integral membrane protein PEX3. Notably, PEX19 engages in diverse protein-protein interactions, forming complexes with a spectrum of peroxisomal membrane proteins, such as PEX10, PEX11A, PEX11B, PEX12, PEX13, PEX14, and PEX16, as well as other crucial components like PXMP2/PMP22, PXMP4/PMP24, SLC25A17/PMP34, ABCD1/ALDP, ABCD2/ALDRP, and ABCD3/PMP70. Additionally, PEX19 plays a role in nuclear exclusion of CDKN2A, preventing its interaction with MDM2 and consequently facilitating the degradation of TP53. Furthermore, it interacts with the tumor suppressor CDKN2A/p19ARF, highlighting its involvement in intricate cellular processes.

Human

E. coli

N-GST

P40855 (A2-C296)

5824  [NCBI]

AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC

59.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.