PEX19 Protein, Human (GST)
The PEX19 protein is critical in early peroxisome biogenesis, serving as a cytosolic chaperone and import receptor for peroxisomal membrane proteins (PMPs). It binds and stabilizes newly synthesized PMP in the cytoplasm, specifically its hydrophobic domain. PEX19 Protein, Human (GST) is the recombinant human-derived PEX19 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PEX19 protein is critical in early peroxisome biogenesis, serving as a cytosolic chaperone and import receptor for peroxisomal membrane proteins (PMPs). It binds and stabilizes newly synthesized PMP in the cytoplasm, specifically its hydrophobic domain. PEX19 Protein, Human (GST) is the recombinant human-derived PEX19 protein, expressed by E. coli , with N-GST labeled tag.
Background
PEX19 protein plays a crucial role in early peroxisomal biogenesis, serving both as a cytosolic chaperone and an import receptor for peroxisomal membrane proteins (PMPs). Its function involves binding to and stabilizing newly synthesized PMPs in the cytoplasm, particularly through interactions with their hydrophobic membrane-spanning domains. Subsequently, PEX19 targets these PMPs to the peroxisome membrane by associating with the integral membrane protein PEX3. Notably, PEX19 engages in diverse protein-protein interactions, forming complexes with a spectrum of peroxisomal membrane proteins, such as PEX10, PEX11A, PEX11B, PEX12, PEX13, PEX14, and PEX16, as well as other crucial components like PXMP2/PMP22, PXMP4/PMP24, SLC25A17/PMP34, ABCD1/ALDP, ABCD2/ALDRP, and ABCD3/PMP70. Additionally, PEX19 plays a role in nuclear exclusion of CDKN2A, preventing its interaction with MDM2 and consequently facilitating the degradation of TP53. Furthermore, it interacts with the tumor suppressor CDKN2A/p19ARF, highlighting its involvement in intricate cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P40855 (A2-C296)
-
Molecular Construction
-
N-term
-
GST
-
PEX19 (A2-C296)
Accession # P40855 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PEX19; PXMP1; Prev. PXF; PMPI; Peroxisomal Farnesylated Protein; 33 KDa Housekeeping Protein; HK33; Housekeeping Gene, 33kD; Peroxin-19; PBD12A; D1S2223E; Peroxisomal Biogenesis Factor 19; PMP1
-
AA Sequence
AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC
-
Predicted Molecular Mass
59.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
