PLXDC2 Protein, Mouse (HEK293, His)

The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PLXDC2 Protein, Mouse (HEK293, His) is 425 a.a., with molecular weight of ~70-90 kDa.

PLXDC2 Protein is implicated in tumor angiogenesis, suggesting its potential involvement in the complex processes associated with the growth of blood vessels within the tumor microenvironment. The specific mechanisms through which PLXDC2 contributes to tumor angiogenesis and its downstream signaling pathways remain to be fully elucidated, warranting further investigation into its role in promoting vascularization during tumorigenesis. Notably, PLXDC2 interacts with CTTN, indicating a potential molecular association that may contribute to its functions in tumor-related angiogenic processes. The intricacies of PLXDC2's role in tumor angiogenesis and its interactions with other cellular components underscore the need for in-depth exploration to better understand its contribution to cancer progression.

Immobilized Mouse PLXDC2 at 2 μg/mL (100 μL/well) can bind Anti-PLXDC2 Antibody, The ED₅₀ for this effect is 1.749 μg/mL.

• 
  Immobilized Mouse PLXDC2 at 2 μg/mL (100 μL/well) can bind Anti-PLXDC2 Antibody, The ED₅₀ for this effect is 1.749 μg/mL.

Mouse

HEK293

C-6*His

Q9DC11 (E31-A455)

67448  [NCBI]

EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHA

Approximately 70-90 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 10% Trehalose, 0.05% Tween 80, pH 3.5 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.