PLXDC2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PLXDC2 protein is associated with tumor angiogenesis, suggesting its potential role in blood vessel growth in the tumor microenvironment. The specific mechanism and downstream signaling pathways by which PLXDC2 promotes tumor angiogenesis need to be further elucidated, thus prompting people to explore its role in promoting vascularization during tumorigenesis. PLXDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLXDC2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PLXDC2 Protein is implicated in tumor angiogenesis, suggesting its potential involvement in the complex processes associated with the growth of blood vessels within the tumor microenvironment. The specific mechanisms through which PLXDC2 contributes to tumor angiogenesis and its downstream signaling pathways remain to be fully elucidated, warranting further investigation into its role in promoting vascularization during tumorigenesis. Notably, PLXDC2 interacts with CTTN, indicating a potential molecular association that may contribute to its functions in tumor-related angiogenic processes. The intricacies of PLXDC2's role in tumor angiogenesis and its interactions with other cellular components underscore the need for in-depth exploration to better understand its contribution to cancer progression.
Verified Bioactivity
Immobilized Mouse PLXDC2 at 2 μg/mL or 5 μg/mL (100 μL/well) can bind Anti-PLXDC2 Antibody, The ED50 for this effect is 0.4-1.749 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9DC11 (E31-A455)
-
Molecular Construction
-
N-term
-
PLXDC2 (E31-A455)
Accession # Q9DC11 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PLXDC2; Plexin Domain-Containing Protein 2; Plexin Domain Containing 2; FLJ14623; TEM7R; Tumor Endothelial Marker 7-Related Precursor; PLXDC2-OT; 1200007L24Rik; Tumor Endothelial Marker 7-Related Protein
-
AA Sequence
EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHA
-
Molecular Weight
Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 10% trehalose, 0.05% Tween 80, pH 3.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
