1. Recombinant Proteins
  2. Others
  3. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO)

Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO)

Cat. No.: HY-P71554
Handling Instructions

Pollen allergen Phl p 5b protein, with ribonuclease activity, is speculated to participate in host-pathogen interactions. Its structural configuration involves a homodimer linked by disulfide bonds, highlighting its molecular arrangement in cellular processes. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is the recombinant Pollen allergen Phl p 5b protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is 265 a.a., with molecular weight of ~42.1 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pollen allergen Phl p 5b protein, with ribonuclease activity, is speculated to participate in host-pathogen interactions. Its structural configuration involves a homodimer linked by disulfide bonds, highlighting its molecular arrangement in cellular processes. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is the recombinant Pollen allergen Phl p 5b protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is 265 a.a., with molecular weight of ~42.1 kDa.

Background

The Pollen allergen Phl p 5b protein exhibits ribonuclease activity and is speculated to play a role in host-pathogen interactions. Structurally, it forms a homodimer that is linked by disulfide bonds, emphasizing its molecular arrangement in cellular processes.

Species

Others

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q40963 (20A-284V)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
Phl p 5b (20A-284V)
Accession # Q40963
C-term
Synonyms
Pollen allergen Phl p 5b; Allergen Phl p Vb; allergen Phl p 5b; Fragment
AA Sequence

ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Molecular Weight

Approximately 42.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO)
Cat. No.:
HY-P71554
Quantity:
MCE Japan Authorized Agent: