Prolactin Protein, Pig (His-SUMO)

Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Prolactin Protein, Pig (His-SUMO) is 199 a.a., with molecular weight of ~39.0 kDa.

Prolactin protein plays a key role in the mammary gland by primarily promoting lactation. This is accomplished through its interaction with the PRLR receptor, which facilitates the process of lactation.

Pig

E. coli

N-His;N-SUMO

P01238 (L31-C229)

396965  [NCBI]

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Approximately 39.0kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.