Prolactin Protein, Pig (His-SUMO)
Based on 1 Customer Validation
Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
Prolactin protein plays a key role in the mammary gland by primarily promoting lactation. This is accomplished through its interaction with the PRLR receptor, which facilitates the process of lactation.
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P01238 (L31-C229)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
Prolactin (L31-C229)
Accession # P01238 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin
-
AA Sequence
LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
-
Predicted Molecular Mass
39 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1.0 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)