PTGES Protein, Mouse (Cell-Free, His, SUMO)

PTGES proteins act as terminal enzymes in COX-2-mediated PGE2 biosynthesis and regulate inflammation, fever, and pain. In response to inflammatory stimuli, PTGES catalyzes the glutathione-dependent redox of PGH2 to PGE2. PTGES Protein, Mouse (Cell-Free, His, SUMO) is the recombinant mouse-derived PTGES protein, expressed by E. coli Cell-free , with N-10*His, N-SUMO labeled tag. The total length of PTGES Protein, Mouse (Cell-Free, His, SUMO) is 153 a.a., with molecular weight of 35.8 kDa.

The PTGES protein serves as the terminal enzyme in the cyclooxygenase (COX)-2-mediated biosynthetic pathway of prostaglandin E2 (PGE2), catalyzing the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to PGE2 in response to inflammatory stimuli. This enzymatic process is integral to the regulation of inflammation, fever, and pain. PTGES not only plays a key role in the production of PGE2 but also exhibits the capability to catalyze the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and 15-hydroperoxy-PGE2 into PGG2. Additionally, it displays low glutathione transferase and glutathione-dependent peroxidase activities toward 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively, showcasing the diverse enzymatic functions of PTGES in cellular responses to various inflammatory stimuli.

Mouse

E. coli Cell-free

N-10*His;N-SUMO

Q9JM51 (M1-L153)

64292

MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

35.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.