PTGR1 Protein, Human (HEK293, His)

PTGR1, a NAD(P)H-dependent oxidoreductase, efficiently metabolizes inflammatory eicosanoids like prostaglandins, leukotrienes, and lipoxins. It actively catalyzes the reduction of the 13,14 double bond in various 15-oxoPGs, including 15-oxo-PGE1 and 15-oxo-PGF2-alpha. PTGR1 also plays a role in detoxifying alkenals and ketones, exhibiting preference for medium-chain length substrates like (2E)-decenal. This multifaceted enzymatic activity underscores PTGR1's significant role in regulating inflammation and detoxifying cytotoxic lipid constituents, contributing to cellular homeostasis. PTGR1 Protein, Human (HEK293, His) is the recombinant human-derived PTGR1 protein, expressed by HEK293, with C-6*His labeled tag. The total length of PTGR1 Protein, Human (HEK293, His) is 329 a.a., with molecular weight of ~38 kDa.

PTGR1 is a NAD(P)H-dependent oxidoreductase actively involved in the metabolic inactivation of both pro- and anti-inflammatory eicosanoids, including prostaglandins (PG), leukotrienes (LT), and lipoxins (LX). This enzyme exhibits high efficiency in catalyzing the reduction of the 13,14 double bond of various 15-oxoPGs, such as 15-oxo-PGE1, 15-oxo-PGE2, 15-oxo-PGF1-alpha, and 15-oxo-PGF2-alpha. Additionally, PTGR1 demonstrates lower efficiency in oxidizing the hydroxyl group at C12 of LTB4 and its derivatives, converting them into less biologically active 12-oxo-LTB4 metabolites. Furthermore, PTGR1 plays a role in the metabolic detoxification of alkenals and ketones, showing a preference for alpha,beta-unsaturated alkenals and ketones with medium-chain length, including (2E)-decenal and (3E)-3-nonen-2-one. This multifaceted enzymatic activity suggests a significant role for PTGR1 in regulating inflammatory responses and detoxifying cytotoxic lipid constituents, such as 4-hydroxy-2-nonenal, thereby contributing to cellular homeostasis.

Human

HEK293

C-6*His

Q14914 (M1-A329)

22949

MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA

Approximately 38 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from sterile 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.