PTGR1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
PTGR1 is an NAD(P)H-dependent oxidoreductase that efficiently metabolizes inflammatory eicosanoids such as prostaglandins, leukotrienes, and lipoxins.It actively catalyzes the reduction of 13,14 double bonds in various 15-oxoPGs, including 15-oxo-PGE1 and 15-oxo-PGF2-alpha.PTGR1 Protein, Human (HEK293, His) is the recombinant human-derived PTGR1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PTGR1 is an NAD(P)H-dependent oxidoreductase that efficiently metabolizes inflammatory eicosanoids such as prostaglandins, leukotrienes, and lipoxins.It actively catalyzes the reduction of 13,14 double bonds in various 15-oxoPGs, including 15-oxo-PGE1 and 15-oxo-PGF2-alpha.PTGR1 Protein, Human (HEK293, His) is the recombinant human-derived PTGR1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PTGR1 is a NAD(P)H-dependent oxidoreductase actively involved in the metabolic inactivation of both pro- and anti-inflammatory eicosanoids, including prostaglandins (PG), leukotrienes (LT), and lipoxins (LX). This enzyme exhibits high efficiency in catalyzing the reduction of the 13,14 double bond of various 15-oxoPGs, such as 15-oxo-PGE1, 15-oxo-PGE2, 15-oxo-PGF1-alpha, and 15-oxo-PGF2-alpha. Additionally, PTGR1 demonstrates lower efficiency in oxidizing the hydroxyl group at C12 of LTB4 and its derivatives, converting them into less biologically active 12-oxo-LTB4 metabolites. Furthermore, PTGR1 plays a role in the metabolic detoxification of alkenals and ketones, showing a preference for alpha,beta-unsaturated alkenals and ketones with medium-chain length, including (2E)-decenal and (3E)-3-nonen-2-one. This multifaceted enzymatic activity suggests a significant role for PTGR1 in regulating inflammatory responses and detoxifying cytotoxic lipid constituents, such as 4-hydroxy-2-nonenal, thereby contributing to cellular homeostasis.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q14914 (M1-A329)
-
Gene ID22949
-
Molecular Construction
-
N-term
-
PTGR1 (M1-A329)
Accession # Q14914 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PTGR1; ZADH3; Prev. LTB4DH; D3T-Inducible Gene 1 Protein; Leukotriene B4 12-Hydroxydehydrogenase; DIG-1; NAD(P)H-Dependent Alkenal/One Oxidoreductase; PRG-1; Dithiolethione-Inducible Gene 1 Protein; NADP-Dependent Leukotriene B4 12-Hydroxydehydrogenase; 1
-
AA Sequence
MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
-
Predicted Molecular Mass
36 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
