Copy Link Print Information

RCN3 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The RCN3 protein is a possible molecular chaperone critical for protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the biosynthesis and transport of key proteins, including SP-A, SP-D, and ABCA3, highlighting the importance of pulmonary surfactant homeostasis. RCN3 Protein, Rat (HEK293, His) is the recombinant rat-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • RCN3 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The RCN3 protein is a possible molecular chaperone critical for protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the biosynthesis and transport of key proteins, including SP-A, SP-D, and ABCA3, highlighting the importance of pulmonary surfactant homeostasis. RCN3 Protein, Rat (HEK293, His) is the recombinant rat-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Background

The RCN3 protein is implicated as a probable molecular chaperone, playing a crucial role in assisting protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the proper biosynthesis and transport of key proteins, including pulmonary surfactant-associated protein A/SP-A, pulmonary surfactant-associated protein D/SP-D, and the lipid transporter ABCA3, highlighting its significance in pulmonary surfactant homeostasis. Moreover, RCN3 demonstrates anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens. Notably, this calcium-binding protein transiently associates with immature PCSK6, regulating its secretion and suggesting a role in the maturation and secretion processes of PCSK6. The multifaceted functions of RCN3 underscore its importance in maintaining cellular homeostasis, particularly in the context of protein biosynthesis, secretion, and anti-fibrotic processes.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    I6L9G5 (K21-H324)

  • Gene ID
    494125  [NCBI]
  • Molecular Construction
    • N-term
    • RCN3 (K21-H324)
      Accession # I6L9G5
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    RCN3; Reticulocalbin 3, EF-Hand Calcium Binding Domain; Reticulocalbin 3; EF-Hand Calcium-Binding Protein RLP49; Reticulocalbin-3; Reticulocabin; RLP49

  • AA Sequence

    KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDQLTPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • RCN3 Protein, Rat (HEK293, His) Product Image
    1/16
  • RCN3 Protein, Rat (HEK293, His) Product Image