REG-3 alpha/REG3A Protein, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities. It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes. REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag. The total length of REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is 149 a.a., with molecular weight of ~18 kDa.

REG-3 alpha (REG3A) protein is predicted to exhibit several functions, including identical protein binding activity, oligosaccharide binding activity, and peptidoglycan binding activity. Its involvement in the negative regulation of keratinocyte differentiation, positive regulation of keratinocyte proliferation, and positive regulation of wound healing highlights its role in skin-related processes. Predicted to be located in the extracellular region and active in the extracellular space, REG3A is prominently expressed in the gut and pancreas. The presence of orthologous genes in humans, such as REG3G (regenerating family member 3 gamma), underscores the evolutionary conservation of its function. Notably, biased expression in tissues like the large intestine and duodenum further emphasizes its specific roles in distinct physiological contexts.

Measured in a cell proliferation assay using H4 human neuroglioma cells. The ED₅₀ for this effect is 0.202 μg/mL, corresponding to a specific activity is 4.960×10³ Unit/mg.

Mouse

HEK293

C-His

NP_035389 (E27-Q175)

19694  [NCBI]

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Approximately 18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.