Copy Link Print Information

REG-3 alpha/REG3A Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • REG-3 alpha/REG3A Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Background

REG-3 alpha (REG3A) protein is predicted to exhibit several functions, including identical protein binding activity, oligosaccharide binding activity, and peptidoglycan binding activity. Its involvement in the negative regulation of keratinocyte differentiation, positive regulation of keratinocyte proliferation, and positive regulation of wound healing highlights its role in skin-related processes. Predicted to be located in the extracellular region and active in the extracellular space, REG3A is prominently expressed in the gut and pancreas. The presence of orthologous genes in humans, such as REG3G (regenerating family member 3 gamma), underscores the evolutionary conservation of its function. Notably, biased expression in tissues like the large intestine and duodenum further emphasizes its specific roles in distinct physiological contexts.

Verified Bioactivity

Measured in a cell proliferation assay using H4 human neuroglioma cells. The ED50 for this effect is 0.202 μg/mL, corresponding to a specific activity is 4.960×103 Unit/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    NP_035389 (E27-Q175)

  • Gene ID
    19694  [NCBI]
  • Molecular Construction
    • N-term
    • REG3A (E27-Q175)
      Accession # NP_035389
    • His
    • C-term
  • Protein Length

    Full Length of prolactin_like

  • Synonyms

    REG3A; Proliferation-Inducing Protein 42; Prev. PAP; Reg III-Alpha; PAP1; REG-3-Alpha; HIP; HIP/PAP; REG-III; CDNA FLJ76569, Highly Similar To Homo Sapiens Regenerating Islet-Derived 3 Alpha (REG3A), Transcript Variant 1, MRNA; PBCGF; Regenerating Islet-D

  • AA Sequence

    EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

  • Molecular Weight

    Approximately 18 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • REG-3 alpha/REG3A Protein, Mouse (HEK293, His) Product Image
    1/16
  • REG-3 alpha/REG3A Protein, Mouse (HEK293, His) Product Image