Resistin Protein, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Resistin, an influential hormone, appears to play a pivotal role in inhibiting insulin's efficacy in promoting glucose uptake into adipose cells, thereby establishing a potential association between obesity and diabetes. Structurally, it adopts a homodimeric form, characterized by stabilizing disulfide linkages. The intricate interplay between resistin and insulin underscores the complex molecular mechanisms involved in metabolic regulation, offering valuable insights into how resistin's actions may contribute to the pathophysiological connections between obesity and the development of diabetes.

Measured in a cell proliferation assay using PC-3 cells. The ED₅₀ for this effect is 32.38 ng/mL, corresponding to a specific activity is 3.09×10^4 units/mg.

• 
  Measured in a cell proliferation assay using PC-3 cells. The ED₅₀ for this effect is 32.38 ng/mL, corresponding to a specific activity is 3.09×10⁴ units/mg.

Mouse

HEK293

N-hFc

Q99P87 (S21-S114)

57264  [NCBI]

Full Length of Mature Protein

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Approximately 39 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.