Resistin Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.
Background
Resistin, an influential hormone, appears to play a pivotal role in inhibiting insulin's efficacy in promoting glucose uptake into adipose cells, thereby establishing a potential association between obesity and diabetes. Structurally, it adopts a homodimeric form, characterized by stabilizing disulfide linkages. The intricate interplay between resistin and insulin underscores the complex molecular mechanisms involved in metabolic regulation, offering valuable insights into how resistin's actions may contribute to the pathophysiological connections between obesity and the development of diabetes.
Verified Bioactivity
Measured in a cell proliferation assay using PC-3 cells. The ED50 for this effect is 32.38 ng/mL, corresponding to a specific activity is 3.09×10^4 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q99P87 (S21-S114)
-
Molecular Construction
-
N-term
-
hFc
-
Resistin (S21-S114)
Accession # Q99P87 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
RETN; Cysteine-Rich Secreted Protein FIZZ3; Resistin; RSTN; FIZZ3; C/EBP-Epsilon Regulated Myeloid-Specific Secreted Cysteine-Rich Protein Precursor 1; ADSF; Found In Inflammatory Zone 3; RETN1; Resistin Delta2; C/EBP-Epsilon-Regulated Myeloid-Specific Se
-
AA Sequence
SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
