1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protein Tyrosine Kinases
  4. RON/MSPR Protein, Human (HEK293, C-His)

RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, C-His) is the recombinant human-derived RON/MSPR, expressed by HEK293, with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, C-His) is the recombinant human-derived RON/MSPR, expressed by HEK293, with C-10*His labeled tag.

Background

The RON/MSPR protein, a receptor tyrosine kinase, functions as a signal transducer from the extracellular matrix by binding to MST1 ligand. It plays a crucial role in regulating various physiological processes, including cell survival, migration, and differentiation. Ligand binding at the cell surface induces autophosphorylation of RON on its intracellular domain, creating docking sites for downstream signaling molecules. Following activation by ligand, RON interacts with the PI3-kinase subunit PIK3R1, PLCG1, or the adapter GAB1, leading to the activation of multiple signaling cascades, such as RAS-ERK, PI3 kinase-AKT, and PLCgamma-PKC. RON signaling contributes to the wound healing response by promoting epithelial cell migration, proliferation, and survival at the wound site. Additionally, RON plays a role in the innate immune response by regulating the migration and phagocytic activity of macrophages. Alternatively, RON can also promote signals such as cell migration and proliferation in response to growth factors other than MST1 ligand.

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized MSP at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human RON. The ED50 for this effect is 0.2613 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized MSP at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human RON. The ED50 for this effect is 0.2613 μg/mL
Species

Human

Source

HEK293

Tag

C-10*His

Accession

Q04912 (E25-L571)

Gene ID

4486

Protein Length

Partial

Synonyms
Macrophage-stimulating protein receptor; p185-Ron; MST1R; PTK8
AA Sequence

EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKL

Molecular Weight

Approximately 33-35 kDa & 36-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RON/MSPR Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RON/MSPR Protein, Human (HEK293, C-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RON/MSPR Protein, Human (HEK293, C-His)
Cat. No.:
HY-P77180A
Quantity:
MCE Japan Authorized Agent: