RON/MSPR Protein, Human (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, C-His) is the recombinant human-derived RON/MSPR, expressed by HEK293, with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, C-His) is the recombinant human-derived RON/MSPR, expressed by HEK293, with C-10*His labeled tag.

Background

The RON/MSPR protein, a receptor tyrosine kinase, functions as a signal transducer from the extracellular matrix by binding to MST1 ligand. It plays a crucial role in regulating various physiological processes, including cell survival, migration, and differentiation. Ligand binding at the cell surface induces autophosphorylation of RON on its intracellular domain, creating docking sites for downstream signaling molecules. Following activation by ligand, RON interacts with the PI3-kinase subunit PIK3R1, PLCG1, or the adapter GAB1, leading to the activation of multiple signaling cascades, such as RAS-ERK, PI3 kinase-AKT, and PLCgamma-PKC. RON signaling contributes to the wound healing response by promoting epithelial cell migration, proliferation, and survival at the wound site. Additionally, RON plays a role in the innate immune response by regulating the migration and phagocytic activity of macrophages. Alternatively, RON can also promote signals such as cell migration and proliferation in response to growth factors other than MST1 ligand.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized MSP at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human RON. The ED50 for this effect is 0.2613 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized MSP at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human RON. The ED50 for this effect is 0.2613 μg/mL

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    MST1R; S13 Avian Erythroblastosis Oncogene Homolog; Prev. PTK8; C-Met-Related Tyrosine Kinase; Prev. RON; MSP Receptor; Prev. SEA; S13 Erythroblastosis (Avian) Oncogene Homolog; CDw136; S13 Erythroblastosis Oncogene Homolog; Macrophage-Stimulating Protein

  • AA Sequence

    EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKL

  • Molecular Weight

    Approximately 33-35 kDa & 36-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00