1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His)

RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His)

Cat. No.: HY-P72784A
COA Handling Instructions

RSPO1, or R-spondin-1, activates the canonical Wnt pathway by ligand binding to LGR4-6 receptors, forming a complex with phosphorylated LRP6 and frizzled receptors. This interaction upregulates target gene expression. RSPO1 inhibits ZNRF3, a Wnt regulator, modulating both canonical and non-canonical Wnt pathways. It acts as a ligand for FZD8 and LRP6, negatively regulating the TGF-beta pathway and influencing ovary determination. RSPO1 counteracts DKK1/KREM1-mediated LRP6 internalization and interacts with FZD8, LRP6, RNF43, LGR5, and heparin, contributing to its diverse role in Wnt pathway regulation. RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293, with C-8*His labeled tag. The total length of RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His) is 126 a.a., with molecular weight of 17-25 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $89 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSPO1, or R-spondin-1, activates the canonical Wnt pathway by ligand binding to LGR4-6 receptors, forming a complex with phosphorylated LRP6 and frizzled receptors. This interaction upregulates target gene expression. RSPO1 inhibits ZNRF3, a Wnt regulator, modulating both canonical and non-canonical Wnt pathways. It acts as a ligand for FZD8 and LRP6, negatively regulating the TGF-beta pathway and influencing ovary determination. RSPO1 counteracts DKK1/KREM1-mediated LRP6 internalization and interacts with FZD8, LRP6, RNF43, LGR5, and heparin, contributing to its diverse role in Wnt pathway regulation. RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293, with C-8*His labeled tag. The total length of RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His) is 126 a.a., with molecular weight of 17-25 kDa.

Background

RSPO1, also known as R-spondin-1, serves as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. Additionally, RSPO1 plays a role in modulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a crucial regulator in the Wnt pathway. Acting as a ligand for frizzled FZD8 and LRP6, RSPO1 also negatively regulates the TGF-beta pathway and has essential functions in ovary determination. Furthermore, RSPO1 regulates Wnt signaling by counteracting DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. The protein interacts with the extracellular domain of FZD8 and LRP6, forms a complex with RNF43, LGR5, and RSPO1, and binds heparin. RSPO1's interactions with ZNRF3 facilitate the membrane clearance of ZNRF3, contributing to its multifaceted role in Wnt pathway regulation.

Species

Human

Source

HEK293

Tag

C-8*His

Accession

Q2MKA7-1 (S21-A146)

Gene ID
Molecular Construction
N-term
RSPO1 (S21-A146)
Accession # Q2MKA7-1
8*His
C-term
Synonyms
R-spondin-1; Roof plate-specific spondin-1; RSPO1
AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPA

Molecular Weight

17-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His)
Cat. No.:
HY-P72784A
Quantity:
MCE Japan Authorized Agent: