S100A8 Protein, Mouse (P.pastoris, His)

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived S100A8 protein, expressed by P.pastoris , with N-His labeled tag.

S100A8 is a protein that plays multiple roles in the immune system and inflammatory processes. It activates the enzyme NADPH-oxidase, which is involved in producing reactive oxygen species (ROS) in immune cells. S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers an essential cofactor called arachidonic acid to the complex.

Mouse

P. pastoris

N-6*His

P27005 (P2-E89)

20201  [NCBI]

Full Length of Mature Protein

PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.