S100A8 Protein, Mouse (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived S100A8 protein, expressed by P.pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived S100A8 protein, expressed by P.pastoris , with N-His labeled tag.

Background

S100A8 is a protein that plays multiple roles in the immune system and inflammatory processes. It activates the enzyme NADPH-oxidase, which is involved in producing reactive oxygen species (ROS) in immune cells. S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers an essential cofactor called arachidonic acid to the complex.

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • S100A8 (P2-E89)
      Accession # P27005
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A8; MRP-8; Prev. CAGA; Urinary Stone Protein Band A; Prev. CFAG; Protein S100-A8; MRP8; Calgranulin A; P8; S100 Calcium-Binding Protein A8; Migration Inhibitory Factor-Related Protein 8; Calgranulin-A; Leukocyte L1 Complex Light Chain; CP-10; Calprote

  • AA Sequence

    PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

  • Predicted Molecular Mass

    12.2 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00