SAA4 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag.
SAA4 Protein stands out as a prominent acute phase reactant, playing a pivotal role in the response to various physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 contributes to the regulation of lipid metabolism and is integral to the dynamics of high-density lipoprotein. Its elevation during acute phase responses underscores its significance in the acute phase reactant network, reflecting its involvement in the body's adaptive mechanisms to diverse stressors.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cancer Biol Ther
MOICS, a novel classier deciphering immune heterogeneity and aid precise management of clear cell renal cell carcinoma at multiomics level. [Abstract]2024 Dec 31;25(1):2345977. PMID: 38659199
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P35542 (E19-Y130)
-
Molecular Construction
-
N-term
-
SAA4 (E19-Y130)
Accession # P35542 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SAA4; CSAA; Serum Amyloid A4, Constitutive; Constitutively Expressed Serum Amyloid A Protein; C-SAA; Serum Amyloid A-4 Protein
-
AA Sequence
ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 200 mM NaCl, 0.5 mM EDTA, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
