SAA4 Protein, Human (His)

SAA4 Protein, a notable acute phase reactant, plays a pivotal role in responding to physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 regulates lipid metabolism and is integral to high-density lipoprotein dynamics. Elevated during acute phase responses, SAA4 underscores its significance in the adaptive mechanisms to diverse stressors. SAA4 Protein, Human (His) is the recombinant human-derived SAA4 protein, expressed by E. coli , with C-6*His labeled tag. The total length of SAA4 Protein, Human (His) is 112 a.a., with molecular weight of ~16 kDa.

SAA4 Protein stands out as a prominent acute phase reactant, playing a pivotal role in the response to various physiological challenges. As a crucial apolipoprotein within the HDL complex, SAA4 contributes to the regulation of lipid metabolism and is integral to the dynamics of high-density lipoprotein. Its elevation during acute phase responses underscores its significance in the acute phase reactant network, reflecting its involvement in the body's adaptive mechanisms to diverse stressors.

Human

E. coli

C-6*His

P35542 (E19-Y130)

6291  [NCBI]

ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY

Approximately 16 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 200 mM NaCl, 0.5 mM EDTA, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.