SARS-CoV-2 S1 Protein (Omicron, B.1.1.529, C-His)

The SARS-Cov-2 S glycoprotein is a SARS-Cov-2 S glycoprotein. The amino acid sequence 1261-1267a.a of the SARS-Cov-2 S glycoprotein is transmembrane. The SARS-Cov-2 S glycoprotein is a highly glycosylated trimer, each of which consists of 1260 amino acids (residues 14-1273), divided into four structural domains: the n-terminal domain (NTD), the c-terminal domain (CTD, also known as the receptor-binding domain, RBD), and two subdomains (SD1 and SD2). SARS-CoV-2 S1 Protein (Omicron, B.1.1.529, C-His) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of SARS-CoV-2 S1 Protein (Omicron, B.1.1.529, C-His) is 670 a.a., with molecular weight of ~130 kDa.

SARS-Cov-2 is a enveloped positive-sense single-stranded RNA virus that causes COVID-19.
SARS-CoV-2 possesses four structural proteins, namely the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M), and nucleocapsid protein (N).
The SARS-Cov-2 S glycoprotein is located on the exterior of the viral particle, giving the coronavirus its crown-like appearance.
The SARS-Cov-2 S glycoprotein can mediate the attachment and entry of viral particles into host cells and is an important target for vaccine development, antibody therapy, and antigen-based diagnostic esting^{[1][2][3][4][5]}.

Virus

HEK293

C-10*His

YP_009724390.1 (V16-R685 with mutations A67V, HV69-70 deletion, T95I, G142D, VYY143-145 deletion, N211 deletion, L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G, H655Y, N679K, P681H)

43740568  [NCBI]

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTKSHRRAR

Approximately 130 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.