Copy Link Print Information

SFRP2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

SFRP2 protein has multiple functions such as Wnt protein binding and receptor ligand activity, and regulates gene expression and signal transduction.It functions upstream in animal organ development, signal transduction, and regulation of endopeptidase activity.SFRP2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for SFRP2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for SFRP2 Protein, Mouse (HEK293, His)
  • SFRP2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SFRP2 protein has multiple functions such as Wnt protein binding and receptor ligand activity, and regulates gene expression and signal transduction.It functions upstream in animal organ development, signal transduction, and regulation of endopeptidase activity.SFRP2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

Background

SFRP2 protein exhibits diverse functions, including Wnt-protein binding activity, endopeptidase activator activity, and receptor ligand activity. It plays a crucial role in regulating gene expression, protein phosphorylation, and signal transduction. Operating upstream of various processes such as animal organ development, negative regulation of signal transduction, and the regulation of endopeptidase activity, SFRP2 is located in the extracellular space. The expression of SFRP2 spans multiple structures, including the alimentary system, brain, embryo mesenchyme, eye, and genitourinary system. The biased expression in specific tissues, such as the limb at embryonic day 14.5 and the adult mammary gland, suggests its involvement in tissue-specific developmental and regulatory processes.

Verified Bioactivity

Measured by its ability to compete with Frizzled-1 for binding to biotinylated Wnt-3a. The IC50 value is 1.48 nM, under conditions in which Recombinant Mouse (rm) Frizzled-1 is present at 2.1 nM, and biotinylated rmWnt-3a concentration is 2.7 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its ability to compete with Frizzled-1 for binding to biotinylated Wnt-3a. The IC50 value of SFRP2 is 1.48 nM, under conditions in which Recombinant Mouse (rm) Frizzled-1 is present at 2.1 nM, and biotinylated rmWnt-3a concentration is 2.7 nM.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    NP_033170.1 (L25-C295)

  • Gene ID
    20319  [NCBI]
  • Molecular Construction
    • N-term
    • SFRP2 (L25-C295)
      Accession # NP_033170.1
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SFRP2; Secreted Apoptosis-Related Protein 1; Secreted Frizzled Related Protein 2; SARP-1; SARP1; SFRP-2; FRP-2; Secreted Apoptosis Related Protein 1; Secreted Frizzled-Related Protein 2; Testicular Tissue Protein Li 170; SDF-5; FRP2

  • AA Sequence

    LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to compete with Frizzled-1 for binding to biotinylated Wnt-3a. The IC50 value of SFRP2 is 1.48 nM, under conditions in which Recombinant Mouse (rm) Frizzled-1 is present at 2.1 nM, and biotinylated rmWnt-3a concentration is 2.7 nM.

  • SFRP2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for SFRP2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for SFRP2 Protein, Mouse (HEK293, His)
  • SFRP2 Protein, Mouse (HEK293, His) Product Image