2. Recombinant Proteins
  3. Others
  4. SLC25A18 Protein, Rat (Cell-Free, His)

SLC25A18 Protein, Rat (Cell-Free, His)

Cat. No.: HY-P702437
Handling Instructions

SLC25A18 Protein transports glutamate molecules from the cytosol into the mitochondrial matrix through a symport system that involves simultaneous proton import. SLC25A18 Protein, Rat (Cell-Free, His) is the recombinant rat-derived SLC25A18 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SLC25A18 Protein, Rat (Cell-Free, His) is 320 a.a., with molecular weight of 35.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLC25A18 Protein transports glutamate molecules from the cytosol into the mitochondrial matrix through a symport system that involves simultaneous proton import. SLC25A18 Protein, Rat (Cell-Free, His) is the recombinant rat-derived SLC25A18 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SLC25A18 Protein, Rat (Cell-Free, His) is 320 a.a., with molecular weight of 35.7 kDa.
Background

SLC25A18 Protein is responsible for facilitating the transportation of glutamate molecules from the cytosol into the mitochondrial matrix, utilizing a symport system that involves the simultaneous import of a proton.
Species

Rat
Source

E. coli Cell-free
Tag

N-10*His
Accession

Q505J6 (M1-E320)
Gene ID

681896
Molecular Construction
N-term
10*His
SLC25A18 (M1-E320)
Accession # Q505J6
C-term
Synonyms
Mitochondrial glutamate carrier 2; Glutamate/H(+) symporter 2; Solute carrier family 25 member 18
AA Sequence

MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLRTQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVSAVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFE

Molecular Weight

35.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

SLC25A18 Protein, Rat (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLC25A18 Protein, Rat (Cell-Free, His)
Cat. No.:
HY-P702437
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.