SLC5A2 Protein, Human (Cell-Free, His, SUMO, Myc)

The SLC5A2 protein, as an electrogenic Na(+)-coupled sugar symporter, actively promotes D-glucose transport across the plasma membrane with a precise Na(+) to sugar coupling ratio of 1:1. As observed in various studies, transporter activity is powered by the transmembrane Na(+) electrochemical gradient established by the Na(+)/K(+) pump. SLC5A2 Protein, Human (Cell-Free, His, SUMO, Myc) is the recombinant human-derived SLC5A2 protein, expressed by E. coli Cell-free , with N-10*His, C-Myc, N-SUMO labeled tag. The total length of SLC5A2 Protein, Human (Cell-Free, His, SUMO, Myc) is 102 a.a., with molecular weight of 30.5 kDa.

SLC5A2 is an electrogenic Na(+)-coupled sugar symporter responsible for actively transporting D-glucose across the plasma membrane, with a 1:1 coupling ratio of Na(+) to sugar. The transporter's activity relies on the transmembrane Na(+) electrochemical gradient, established by the Na(+)/K(+) pump. Primarily, SLC5A2 plays a crucial role in the reabsorption of D-glucose from the glomerular filtrate, functioning at the brush border of the early proximal tubules in the kidney. This symporter's activity is essential for the maintenance of glucose homeostasis by efficiently retrieving glucose from the filtrate, contributing to the overall renal handling of glucose in the body.

Human

E. coli Cell-free

N-10*His;C-Myc;N-SUMO

P31639 (M1-A102)

6524

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

30.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.