1. Recombinant Proteins
  2. Others
  3. SMNDC1/SPF30 Protein, Human (His)

SMNDC1/SPF30 Protein is pivotal in spliceosome assembly, forming associations with spliceosomes, U4/U5/U6 tri-snRNP, and U2 snRNP. Its Tudor domain directly interacts with SNRPD3, emphasizing its crucial role in essential interactions within the splicing machinery and contributing to the intricate process of pre-mRNA splicing. SMNDC1/SPF30 Protein, Human (His) is the recombinant human-derived SMNDC1/SPF30 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SMNDC1/SPF30 Protein is pivotal in spliceosome assembly, forming associations with spliceosomes, U4/U5/U6 tri-snRNP, and U2 snRNP. Its Tudor domain directly interacts with SNRPD3, emphasizing its crucial role in essential interactions within the splicing machinery and contributing to the intricate process of pre-mRNA splicing. SMNDC1/SPF30 Protein, Human (His) is the recombinant human-derived SMNDC1/SPF30 protein, expressed by E. coli , with N-6*His labeled tag.

Background

SMNDC1/SPF30 protein plays a crucial role in spliceosome assembly, forming associations with spliceosomes and U4/U5/U6 tri-snRNP, as well as U2 snRNP. It directly interacts with SNRPD3 through its Tudor domain, emphasizing its involvement in critical interactions within the splicing machinery, contributing to the intricate process of pre-mRNA splicing.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O75940 (M1-Q238)

Gene ID
Molecular Construction
N-term
6*His
SMNDC1 (M1-Q238)
Accession # O75940
C-term
Protein Length

Full Length

Synonyms
Survival of motor neuron-related-splicing factor 30; SMNDC1; SMNR; SPF30
AA Sequence

MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Molecular Weight

Approximately 29 kDa

Purity
  • ≥ 85%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SMNDC1/SPF30 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SMNDC1/SPF30 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SMNDC1/SPF30 Protein, Human (His)
Cat. No.:
HY-P73635
Quantity:
MCE Japan Authorized Agent: