SMNDC1/SPF30 Protein, Human (His)
Based on 1 Customer Validation
SMNDC1/SPF30 Protein is pivotal in spliceosome assembly, forming associations with spliceosomes, U4/U5/U6 tri-snRNP, and U2 snRNP. Its Tudor domain directly interacts with SNRPD3, emphasizing its crucial role in essential interactions within the splicing machinery and contributing to the intricate process of pre-mRNA splicing. SMNDC1/SPF30 Protein, Human (His) is the recombinant human-derived SMNDC1/SPF30 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SMNDC1/SPF30 Protein is pivotal in spliceosome assembly, forming associations with spliceosomes, U4/U5/U6 tri-snRNP, and U2 snRNP. Its Tudor domain directly interacts with SNRPD3, emphasizing its crucial role in essential interactions within the splicing machinery and contributing to the intricate process of pre-mRNA splicing. SMNDC1/SPF30 Protein, Human (His) is the recombinant human-derived SMNDC1/SPF30 protein, expressed by E. coli , with N-6*His labeled tag.
Background
SMNDC1/SPF30 protein plays a crucial role in spliceosome assembly, forming associations with spliceosomes and U4/U5/U6 tri-snRNP, as well as U2 snRNP. It directly interacts with SNRPD3 through its Tudor domain, emphasizing its involvement in critical interactions within the splicing machinery, contributing to the intricate process of pre-mRNA splicing.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O75940 (M1-Q238)
-
Molecular Construction
-
N-term
-
6*His
-
SMNDC1 (M1-Q238)
Accession # O75940 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SMNDC1; Survival Of Motor Neuron-Related-Splicing Factor 30; Survival Motor Neuron Domain Containing 1; Survival Motor Neuron Domain-Containing Protein 1; SPF30; 30 KDa Splicing Factor SMNrp; SMNR; Tudor Domain Containing 16C; TDRD16C; SMN-Related Protein
-
AA Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
