ST2/IL1RL1 Protein, Human (310a.a, HEK293, His)
Based on 1 publication(s) in Google Scholar
ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.
Background
ST2/IL1RL1 protein serves as a potent inhibitor of IL-33 signaling.
Verified Bioactivity
1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×106 units/mg.
2.Measured by its ability to bind human IL33 in functional Elisa.
3. Loaded ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) on AHC2 biosensor, can bind Astegolimab (HY-P99444) with an affinity constant of 2.022E-10 M as determined in BLI assay.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Int Immunopharmacol
Mechanism of action of miR-15b-5p in alleviating asthma airway remodeling through the HMGB1/TLR4/IL-33 signaling axis. [Abstract]2025 Jan 3:145:113753. PMID: 39644790
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q01638-2 (K19-F328)
-
Molecular Construction
-
N-term
-
ST2 (K19-F328)
Accession # Q01638-2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL1RL1; ST2V; Interleukin 1 Receptor Like 1; Homolog Of Mouse Growth Stimulation-Expressed; DER4; Suppressor Of Tumorigenicity 2; ST2; Interleukin 1 Receptor-Like 1 Isoform 2; T1; Interleukin 1 Receptor-Like 1 Isoform 1; Interleukin-1 Receptor-Like 1; Int
-
AA Sequence
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF
-
Molecular Weight
Approximately 48-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
