Stathmin Protein, Human (C-His)

Stathmin proteins critically regulate the microtubule filament system by actively destabilizing microtubules, inhibiting assembly, and promoting disassembly. Phosphorylation of Ser-16 is critical for axon formation during neurogenesis, highlighting its importance in neuronal development. Stathmin Protein, Human (C-His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Stathmin Protein, Human (C-His) is 148 a.a., with molecular weight of ~20.0 kDa.

The Stathmin Protein plays a crucial role in regulating the microtubule filament system by actively destabilizing microtubules, thereby preventing their assembly and promoting disassembly. The phosphorylation of Stathmin at Ser-16 may be a key requirement for axon formation during neurogenesis, emphasizing its significance in neuronal development. Beyond its role in cellular architecture, Stathmin is implicated in the control of both learned and innate fear, indicating its potential involvement in complex behavioral processes. The protein binds to two alpha/beta-tubulin heterodimers, forming interactions critical for its microtubule-regulating functions. Additionally, Stathmin interacts with KIST, further expanding its network of molecular associations and suggesting its involvement in diverse cellular processes.

Human

E. coli

C-6*His

P16949 (A2-D149)

3925  [NCBI]

ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Approximately 20.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.