STEAP1 Protein, Mouse (Cell-Free, His)

The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The STEAP1 protein is classified as a member of the metal reductase family and cannot function as a functional metal reductase, mainly due to the lack of binding sites for the electron-donating substrate NADPH. This unique feature distinguishes STEAP1 from typical metal reductases, which are characterized by their ability to catalyze the reduction of metal ions using NADPH as an electron donor. STEAP1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived STEAP1 protein, expressed by E. coli Cell-free , with C-10*His labeled tag.

Background

STEAP1 (Six-Transmembrane Epithelial Antigen of the Prostate 1) protein, as indicated by available information, does not operate as a metalloreductase primarily because it lacks binding sites for the electron-donating substrate NADPH. Metalloreductases play a crucial role in cellular processes by reducing metal ions, but the absence of NADPH binding sites in STEAP1 suggests a distinct functional profile. This observation highlights the importance of understanding the structural and biochemical features of STEAP1 in elucidating its role within cellular pathways. Further research is necessary to uncover the specific functions and implications associated with STEAP1, both in normal cellular processes and potential connections to diseases or physiological conditions, as its distinctive characteristics may contribute to its unique role within the cellular environment. (

Technical Parameters

  • Species Mouse
  • Source E. coli Cell-free
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • STEAP1 (M1-L339)
      Accession # Q9CWR7
    • 10*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    STEAP1; Six-Transmembrane Epithelial Antigen Of Prostate 1; Prev. STEAP; STEAP1 Protein; PRSS24; Six Transmembrane Epithelial Antigen Of The Prostate; Six Transmembrane Epithelial Antigen Of The Prostate 1; Metalloreductase STEAP1; STEAP Family Member 1;

  • AA Sequence

    MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL

  • Predicted Molecular Mass

    40.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00