STX17 Protein, Human (Cell-Free, His)

STX17 is a key SNARE protein that plays a crucial role in mediating cell membrane fusion, particularly in autophagy. Assembles into the trans-SNARE complex, which drives fusion via an extended four-α-helix bundle. STX17 Protein, Human (Cell-Free, His) is the recombinant human-derived STX17 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of STX17 Protein, Human (Cell-Free, His) is 301 a.a., with molecular weight of 34.8 kDa.

STX17, a pivotal member of the SNARE (soluble N-ethylmaleimide-sensitive factor-attachment protein receptor) family, assumes a crucial role in mediating the fusion of cellular membranes. This SNARE protein is localized on opposing membranes, where it assembles into a trans-SNARE complex—an extended, parallel four alpha-helical bundle that serves as the driving force behind membrane fusion. Specifically implicated in autophagy, STX17 exerts direct control over autophagosome membrane fusion with the lysosome membrane. Additionally, it may participate in the early secretory pathway, influencing the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi, and regulating transport between the endoplasmic reticulum, ERGIC, and Golgi. Within the context of autophagy, STX17 forms a SNARE complex alongside VAMP8 and SNAP29, orchestrating the fusion of autophagosomes with lysosomes. The protein engages in a myriad of interactions, including VAMP7, VTI1B, BET1, SCFD1, SEC22B, PTPN2, ABL1, COPB1, TMED9, TMED10, ATG14, RUBCNL/PACER, VPS39, VPS41, IRGM, GABARAP, and MAP1LC3B, highlighting its versatile molecular associations in various cellular processes.

Human

E. coli Cell-free

N-10*His

P56962 (S2-S302)

55014

SEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKKCS

34.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.