Synaptotagmin VI Protein, Human (N-His)
Based on 1 Customer Validation
The Ptk7 protein is a receptor involved in multiple cellular processes, including cell proliferation and migration. It plays a crucial role in regulating embryonic development and tissue homeostasis. Synaptotagmin VI Protein, Human (N-His) is the recombinant human-derived Synaptotagmin VI protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Ptk7 protein is a receptor involved in multiple cellular processes, including cell proliferation and migration. It plays a crucial role in regulating embryonic development and tissue homeostasis. Synaptotagmin VI Protein, Human (N-His) is the recombinant human-derived Synaptotagmin VI protein, expressed by E. coli , with N-His labeled tag.
Background
Synaptotagmin VI protein, a member of the synaptotagmin family, possesses a common domain structure comprising a transmembrane domain and a cytoplasmic region consisting of 2 C2 domains. These proteins play a vital role in calcium-dependent exocytosis of synaptic vesicles. Specifically, synaptotagmin VI is a crucial component of the secretory machinery involved in acrosomal exocytosis. This gene exhibits alternatively spliced transcript variants. Furthermore, it demonstrates biased expression in specific tissues, including the brain (RPKM 2.6), kidney (RPKM 0.8), and 6 other tissues.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
NP_995320 (V275-L425)
-
Gene ID148281
-
Molecular Construction
-
N-term
-
His
-
Synaptotagmin VI (V275-L425)
Accession # NP_995320 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SYT6; Synaptotagmin-6; Synaptotagmin 6; SytVI; Synaptotagmin VI; Synaptotagmin VI, Isoform CRA_b
-
AA Sequence
VDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRL
-
Predicted Molecular Mass
17.2 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)