SYNGR1/Synaptogyrin-1 Protein, Rat (Cell-Free, His)

SYNGR1, also known as Synaptogyrin-1 protein, has been implicated in regulated exocytosis, suggesting a role in controlled neurotransmitter release. It regulates the localization of synaptophysin/SYP in synaptophysin-like microvesicles, affecting vesicle formation and maturation. SYNGR1/Synaptogyrin-1 Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYNGR1/Synaptogyrin-1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SYNGR1/Synaptogyrin-1 Protein, Rat (Cell-Free, His) is 234 a.a., with molecular weight of 31.7 kDa.

SYNGR1, also known as Synaptogyrin-1 protein, emerges as a potential player in regulated exocytosis, suggesting its involvement in the controlled release of neurotransmitters. Notably, SYNGR1 is implicated in modulating the localization of synaptophysin/SYP into synaptic-like microvesicles, hinting at its role in the formation and maturation of these vesicles. The multifaceted role of SYNGR1 extends to the regulation of both short-term and long-term synaptic plasticity, underscoring its significance in shaping the dynamic aspects of synaptic function. The intricate molecular mechanisms underlying SYNGR1's participation in these processes present an intriguing area for further investigation to comprehensively understand its contributions to cellular events related to exocytosis and synaptic plasticity.

Rat

E. coli Cell-free

N-10*His

Q62876 (M1-Y234)

29205

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWVFSIVVFGSIVNEGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLVYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFFWFVGFCFLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPSAGSDPTGMGGTYQHPANAFDAEPQGYQSQGY

31.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.