SYNPR/Synaptoporin Protein, Rat (Cell-Free, His)
SYNPR (Synaptoporin) functions as an intrinsic membrane protein in small synaptic vesicles, identified as a probable vesicular channel protein. SYNPR/Synaptoporin Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYNPR/Synaptoporin protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Rat
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SYNPR (Synaptoporin) functions as an intrinsic membrane protein in small synaptic vesicles, identified as a probable vesicular channel protein. SYNPR/Synaptoporin Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYNPR/Synaptoporin protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
SYNPR, also known as Synaptoporin, serves as an intrinsic membrane protein located in small synaptic vesicles and is identified as a probable vesicular channel protein.
Technical Parameters
-
Species Rat
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P22831 (M1-I265)
-
Gene ID66030
-
Molecular Construction
-
N-term
-
10*His
-
SYNPR (M1-I265)
Accession # P22831 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Synaptoporin; Synpr
-
AA Sequence
MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSGGYSQQASLGPTSDEFGQQPSGPTSFNNQI
-
Predicted Molecular Mass
35.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
