TCblR/CD320 Protein, Rat (HEK293, Fc)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) and is critical for cobalamin uptake and can influence cell physiology. At the plasma membrane, it is expressed on follicular dendritic cells (FDC), where it helps interact with germinal center B cells and promotes immune responses. TCblR/CD320 Protein, Rat (HEK293, Fc) is the recombinant rat-derived TCblR/CD320 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TCblR/CD320 Protein, Rat (HEK293, Fc) is 182 a.a., with molecular weight of ~47.3 KDa.

TCblR/CD320 Protein, as the receptor for transcobalamin saturated with cobalamin (TCbl), assumes a crucial role in cobalamin uptake, demonstrating its significance in cellular physiology. Positioned on the plasma membrane, this receptor is notably expressed on follicular dendritic cells (FDC), facilitating interaction with germinal center B cells and contributing to the intricate network of immune responses. Functioning as a costimulator, TCblR promotes B cell responses to antigenic stimuli, thereby fostering B cell differentiation and proliferation. Specifically, it plays a vital role in the differentiation of germinal center-B (GC-B) cells into memory B-cells and plasma cells (PC) through collaborative interactions with T-cells and FDC. Notably, CD320 enhances the proliferation of PC precursors generated by IL-10, showcasing its multifaceted involvement in immune modulation. The interaction of TCblR with TCN2 further highlights its role in cobalamin homeostasis and cellular processes.

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD320 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse TCN2. The ED₅₀ for this effect is 0.1918 μg/mL.

Rat

HEK293

C-hFc

Q5HZW5/NP_001014223.1 (A29-A210)

362851  [NCBI]

APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRIEPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRCDGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNPNA

Approximately 65-70 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.