Copy Link Print Information

TFPI Protein, Rabbit (HEK293, His)

Customer Review

Based on 1 Customer Validation

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TFPI Protein, Rabbit (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag.

Background

TFPI (Tissue Factor Pathway Inhibitor) exerts direct inhibition on factor X (Xa) and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This multifunctional protein showcases antithrombotic properties and demonstrates an affinity for association with lipoproteins in plasma, highlighting its pivotal role in regulating the intricate dynamics of the coagulation pathway.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized TFPI, Rabbit (HEK293, His) at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC50 is ≤6 ng/mL.

Technical Parameters

  • Species Rabbit
  • Source HEK293
  • Tag N-10*His
  • Accession

    P19761 (A25-T300)

  • Gene ID
    100009401  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • TFPI (A25-T300)
      Accession # P19761
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TFPI; EPI; Prev. LACI; Tissue Factor Pathway Inhibitor (Lipoprotein-Associated Coagulation Inhibitor); Extrinsic Pathway Inhibitor; Lipoprotein-Associated Coagulation Inhibitor; TFPI1; Anti-Convertin; Tissue Factor Pathway Inhibitor; TFI

  • AA Sequence

    AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

  • Predicted Molecular Mass

    35.4 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TFPI Protein, Rabbit (HEK293, His) Product Image
    1/16
  • TFPI Protein, Rabbit (HEK293, His) Product Image