2. Recombinant Proteins
  3. Others
  4. TFPI Protein, Rabbit (HEK293, His)

TFPI Protein, Rabbit (HEK293, His)

Cat. No.: HY-P700431
Handling Instructions

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag. The total length of TFPI Protein, Rabbit (HEK293, His) is 276 a.a., with molecular weight of 35.4 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag. The total length of TFPI Protein, Rabbit (HEK293, His) is 276 a.a., with molecular weight of 35.4 kDa.
Background

TFPI (Tissue Factor Pathway Inhibitor) exerts direct inhibition on factor X (Xa) and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This multifunctional protein showcases antithrombotic properties and demonstrates an affinity for association with lipoproteins in plasma, highlighting its pivotal role in regulating the intricate dynamics of the coagulation pathway.
Species

Rabbit
Source

HEK293
Tag

N-10*His
Accession

P19761 (A25-T300)
Gene ID

100009401  [NCBI]
Molecular Construction
N-term
10*His
TFPI (A25-T300)
Accession # P19761
C-term
Synonyms
TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); LACI; tissue factor pathway inhibitor; EPI; extrinsic pathway inhibitor; TFI; TFPI1; anti-convertin;
AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Molecular Weight

35.4 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

TFPI Protein, Rabbit (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI Protein, Rabbit (HEK293, His)
Cat. No.:
HY-P700431
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.