2. Recombinant Proteins
  3. Others
  4. Thrombospondin-2 Protein, Mouse (P.pastoris, His)

Thrombospondin-2 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P702564
Handling Instructions

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Thrombospondin-2 Protein, Mouse (P.pastoris, His) is 214 a.a., with molecular weight of 26.1 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Thrombospondin-2 Protein, Mouse (P.pastoris, His) is 214 a.a., with molecular weight of 26.1 kDa.
Background

Thrombospondin-2 protein is a disulfide-linked homotrimeric adhesion glycoprotein belonging to the thrombospondin family. Thrombospondin-2 is a CD36 ligand with anti-angiogenic properties that mediates cell-cell and cell-matrix interactions. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.
Species

Mouse
Source

P. pastoris
Tag

N-6*His
Accession

Q03350 (G19-A232)
Gene ID

21826
Molecular Construction
N-term
6*His
Thrombospondin-2 (G19-A232)
Accession # Q03350
C-term
Synonyms
Thbs2; Tsp2; Thrombospondin-2
AA Sequence

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Molecular Weight

26.1kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Thrombospondin-2 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thrombospondin-2 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P702564
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.