Copy Link Print Information

Thy1/CD90 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

Thy1/CD90 Protein is a member of the immunoglobulin family. It plays a role in cell adhesion and cell communication in many cell types, especially in cells of the immune and nervous systems.Thy1/CD90 protein has multiple immune functions and also participates in the regulation of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. Thy1/CD90 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Thy1/CD90 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Thy1/CD90 Protein is a member of the immunoglobulin family. It plays a role in cell adhesion and cell communication in many cell types, especially in cells of the immune and nervous systems.Thy1/CD90 protein has multiple immune functions and also participates in the regulation of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. Thy1/CD90 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Background

Thy1/CD90 Protein has multiple immune functions. Most of them are mediated through interactions with integrins[1][2].
Thy1/CD90 Protein is an activation determinant. The binding and cross-linking of Thy1/CD90 Protein on the surface of T cells by MAb may lead to T cell activation in a manner similar to that of plant lectins, resulting in the production of polyclonal interleukin-2 (IL-2), expression of IL-2R, and proliferation[3].
Thy1/CD90 protein acts as a regulator of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. It also affects many non-immune biological processes[4].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD90 is immobilized at 5.00 µg/mL (100 µL/well), recombinant Human Galectin-1 binds with an ED50 of 0.4373 μg/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession

    A0A2K5U4H6 (Q20-K129)

  • Gene ID
    102139037  [NCBI]
  • Molecular Construction
    • N-term
    • Thy1 (Q20-K129)
      Accession # A0A2K5U4H6
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    THY1; CDNA, FLJ94676, Homo Sapiens Thy-1 Co-Transcribed (LOC94105), MRNA; Thy-1 Cell Surface Antigen; Thy-1 Membrane Glycoprotein Variant 1; Thy-1 Membrane Glycoprotein; Thy-1 Co-Transcribed Protein; Thy-1 Antigen; Thy-1 T-Cell Antigen; CD90; CD90 Antigen

  • AA Sequence

    QKVTSLTACLVDQSLRLDCRHENTTSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVK

  • Predicted Molecular Mass

    12.5 kDa

  • Molecular Weight

    Approximately 27-32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Thy1/CD90 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Thy1/CD90 Protein, Cynomolgus (HEK293, His) Product Image