Thy1/CD90 Protein, Cynomolgus (HEK293, His)

Thy1/CD90 Protein is a member of the immunoglobulin family. It plays a role in cell adhesion and cell communication in many cell types, especially in cells of the immune and nervous systems.Thy1/CD90 protein has multiple immune functions and also participates in the regulation of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. Thy1/CD90 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Cynomolgus (HEK293, His) is 110 a.a., with molecular weight of 27-32 kDa.

Thy1/CD90 Protein has multiple immune functions. Most of them are mediated through interactions with integrins^[1][2].
Thy1/CD90 Protein is an activation determinant. The binding and cross-linking of Thy1/CD90 Protein on the surface of T cells by MAb may lead to T cell activation in a manner similar to that of plant lectins, resulting in the production of polyclonal interleukin-2 (IL-2), expression of IL-2R, and proliferation^[3].
Thy1/CD90 protein acts as a regulator of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. It also affects many non-immune biological processes^[4].

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD90 is immobilized at 5.00 µg/mL (100 µL/well), recombinant Human Galectin-1 binds with an ED₅₀ of 0.4373 μg/mL.

Cynomolgus

HEK293

C-His

A0A2K5U4H6 (Q20-K129)

102139037  [NCBI]

QKVTSLTACLVDQSLRLDCRHENTTSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVK

Approximately 27 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.