Thy1/CD90 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Thy1/CD90 protein may play a role in key cellular processes associated with neurodevelopment, particularly during synaptogenesis and other brain events, suggesting its involvement in cell-cell or cell-ligand interactions. Thy1/CD90 Protein, Rat (HEK293, His) is the recombinant rat-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Thy1/CD90 protein may play a role in key cellular processes associated with neurodevelopment, particularly during synaptogenesis and other brain events, suggesting its involvement in cell-cell or cell-ligand interactions. Thy1/CD90 Protein, Rat (HEK293, His) is the recombinant rat-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Thy1/CD90 protein is suggested to potentially play a role in cell-cell or cell-ligand interactions, particularly during synaptogenesis and other events in the brain, indicating its involvement in critical processes related to neural development and synaptic connectivity. The precise mechanisms and specific contexts in which Thy1/CD90 operates during these events remain areas of interest, underscoring its potential significance in orchestrating cellular interactions in the intricate landscape of the brain. The versatility of Thy1/CD90 in mediating cell communication and potentially influencing synaptic formation emphasizes the need for further exploration to elucidate its exact functions and molecular mechanisms in these dynamic processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD90 is immobilized at 5.00 µg/mL (100 µL/well) can bind Human Galectin-1. The ED50 for this effect is 0.3630 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Thy1 (Q20-K129)
      Accession # P01830
    • His
    • C-term
  • Protein Length

    Full Length of Ig-like V-type Domain

  • Synonyms

    THY1; CDNA, FLJ94676, Homo Sapiens Thy-1 Co-Transcribed (LOC94105), MRNA; Thy-1 Cell Surface Antigen; Thy-1 Membrane Glycoprotein Variant 1; Thy-1 Membrane Glycoprotein; Thy-1 Co-Transcribed Protein; Thy-1 Antigen; Thy-1 T-Cell Antigen; CD90; CD90 Antigen

  • AA Sequence

    QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVK

  • Predicted Molecular Mass

    12.7 kDa

  • Molecular Weight

    Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00