Thy1/CD90 Protein, Rat (HEK293, His)

The Thy1/CD90 protein may play a role in key cellular processes associated with neurodevelopment, particularly during synaptogenesis and other brain events, suggesting its involvement in cell-cell or cell-ligand interactions. Thy1/CD90 Protein, Rat (HEK293, His) is the recombinant rat-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Rat (HEK293, His) is 110 a.a., with molecular weight of ~23-27 kDa.

The Thy1/CD90 protein is suggested to potentially play a role in cell-cell or cell-ligand interactions, particularly during synaptogenesis and other events in the brain, indicating its involvement in critical processes related to neural development and synaptic connectivity. The precise mechanisms and specific contexts in which Thy1/CD90 operates during these events remain areas of interest, underscoring its potential significance in orchestrating cellular interactions in the intricate landscape of the brain. The versatility of Thy1/CD90 in mediating cell communication and potentially influencing synaptic formation emphasizes the need for further exploration to elucidate its exact functions and molecular mechanisms in these dynamic processes.

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD90 is immobilized at 5.00 µg/mL (100 µL/well) can bind Human Galectin-1. The ED₅₀ for this effect is 0.3630 μg/mL.

Rat

HEK293

C-His

P01830 (Q20-K129)

24832  [NCBI]

QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVK

Approximately 23-27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.