TLE3 Protein, Human (GST)

The TLE3 protein is a transcriptional corepressor that inhibits Wnt signaling by binding to transcription factors such as CTNNB1 and TCF family members. It forms homotetramers, hetero-oligomers, and interacts with AES. TLE3 Protein, Human (GST) is the recombinant human-derived TLE3 protein, expressed by E. coli , with N-GST labeled tag. The total length of TLE3 Protein, Human (GST) is 289 a.a., with molecular weight of ~58.5 kDa.

TLE3, a transcriptional corepressor, intricately regulates gene expression by binding to various transcription factors and exerting inhibitory effects on transcriptional activation mediated by CTNNB1 and TCF family members in the Wnt signaling pathway. TLE3 forms homotetramers and heterooligomers with other family members, and its regulatory influence may be modulated by its association with the dominant-negative factor AES. Among its molecular interactions, TLE3 binds to LEF1, TCF7, and TCF7L1, establishing its involvement in modulating the transcriptional activities of these crucial factors. Additionally, TLE3 engages in protein-protein interactions with FOXA2, XIAP/BIRC4, and TCF7L2/TCF4. Notably, its interaction with TBX18, involving the engrailed homology 1 repressor motif, leads to a reduction in TBX18's transcriptional activity, underscoring TLE3's role in finely tuning specific transcriptional responses.

Human

E. coli

N-His

Q04726 (S484-Y772)

7090  [NCBI]

SHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY

Approximately 32 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCL, 150 mM NaCl, 5 mM GSH, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.