TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His)

The TM4SF2/TSPAN7 Protein, a crucial tetraspanin family member, plays an essential role in signal transduction, cell adhesion, and membrane organization. Its study enhances understanding of cell membrane dynamics and offers potential applications in cell biology and cancer research. Classification within the tetraspanin family emphasizes unique contributions to diverse physiological processes. Further exploration promises insights into TM4SF2/TSPAN7's role in both normal physiology and pathological conditions. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293, with N-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is 101 a.a., with molecular weight of 20-28 kDa.

The TM4SF2/TSPAN7 Protein is a pivotal member of the tetraspanin (TM4SF) family, highlighting its essential role in various cellular processes, including signal transduction, cell adhesion, and membrane organization. As part of this family, TM4SF2/TSPAN7 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane dynamics. The study of TM4SF2/TSPAN7 contributes to our understanding of its role in diverse physiological processes, offering potential applications in cell biology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of TM4SF2/TSPAN7's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

When Recombinant Cynomolgus TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody. The ED₅₀ for this effect is 171.7 ng/mL.

Cynomolgus

HEK293

N-His

Q4R5A3 (R113-M213)

102127880  [NCBI]

RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLDHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Approximately 17-28 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.