TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
TM4SF2/TSPAN7 protein is an important member of the tetraspanin family and plays an important role in signal transduction, cell adhesion, and membrane organization. Its research enhances understanding of cell membrane dynamics and provides potential applications in cell biology and cancer research. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TM4SF2/TSPAN7 protein is an important member of the tetraspanin family and plays an important role in signal transduction, cell adhesion, and membrane organization. Its research enhances understanding of cell membrane dynamics and provides potential applications in cell biology and cancer research. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.
Background
The TM4SF2/TSPAN7 Protein is a pivotal member of the tetraspanin (TM4SF) family, highlighting its essential role in various cellular processes, including signal transduction, cell adhesion, and membrane organization. As part of this family, TM4SF2/TSPAN7 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane dynamics. The study of TM4SF2/TSPAN7 contributes to our understanding of its role in diverse physiological processes, offering potential applications in cell biology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of TM4SF2/TSPAN7's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.
Verified Bioactivity
When Recombinant Cynomolgus TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody. The ED50 for this effect is 171.7 ng/mL.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-His
-
Accession
Q4R5A3 (R113-M213)
-
Molecular Construction
-
N-term
-
His
-
TM4SF2 (R113-M213)
Accession # Q4R5A3 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Mxs1; Tm4sf2; Tetraspanin-7; Tspan-7; Cell surface glycoprotein A15; PE31; TALLA homolog; Transmembrane 4 superfamily member 2; CD antigen; CD231; XLID58; CCG-B7; TM4SF2b; Tetraspanin; Tetraspanin Protein; Transmembrane 4 Superfamily 2b; Transmembrane Pro
-
AA Sequence
RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLDHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
-
Predicted Molecular Mass
11.6 kDa
-
Molecular Weight
Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
