Copy Link Print Information

TM4SF2/TSPAN7 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TM4SF2/TSPAN7 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Background

TM4SF2/TSPAN7 Protein regulates the transport of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors, participates in synaptic transmission, neuronal morphogenesis, and DCs and osteoblasts morphogenesis. M4SF2/TSPAN7 Protein participates in the spinal maturation of cultured hippocampal neurons through direct interaction with PICK1[1].
Overexpression of TM4SF2/TSPAN7 protein promotes the formation of filopodia and dendritic spines in embryonic rat hippocampal neuronal cultures. Silencing of TM4SF2/TSPAN7 protein reduces head size and spine stability as well as AMPA receptor currents.[2].
TM4SF2/TSPAN7 protein promotes the epithelial-mesenchymal transition (EMT) process by reducing the expression of E-cadherin and vimentin, thereby promoting the proliferation and migration of non-small cell lung cancer (NSCLC) cells[3] TM4SF2/TSPAN7 Protein induces apoptosis and cell cycle arrest in bladder cancer cell lines. TM4SF2/TSPAN7 Protein inhibits the growth of bladder cancer cells by activating Bax, cleaved Caspase-3 and PTEN and inactivating Bcl-2, p-PI3K and p-AKT[4].

Verified Bioactivity

When Recombinant Rat TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody. The ED50 for this effect is 173.6 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag N-His
  • Accession

    ABX10436 (R108-M208)

  • Gene ID
    363447  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • TM4SF2 (R108-M208)
      Accession # ABX10436
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    Mxs1; Tm4sf2; Tetraspanin-7; Tspan-7; Cell surface glycoprotein A15; PE31; TALLA homolog; Transmembrane 4 superfamily member 2; CD antigen; CD231; XLID58; CCG-B7; TM4SF2b; Tetraspanin; Tetraspanin Protein; Transmembrane 4 Superfamily 2b; Transmembrane Pro

  • AA Sequence

    RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

  • Predicted Molecular Mass

    11.6 kDa

  • Molecular Weight

    Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TM4SF2/TSPAN7 Protein, Rat (HEK293, His) Product Image
    1/16
  • TM4SF2/TSPAN7 Protein, Rat (HEK293, His) Product Image