TNF-alpha/TNFSF2 Protein, Equine
Based on 1 Customer Validation
TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, fever, cachexia, cell proliferation, and cell differentiation. It also causes insulin resistance and GKAP42 protein degradation in adipocytes. Additionally, it plays a role in angiogenesis, osteoclastogenesis, and IL12 production in dendritic cells. TNF-alpha/TNFSF2 Protein, Equine is the recombinant equine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with tag free.
- Species: Equine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, fever, cachexia, cell proliferation, and cell differentiation. It also causes insulin resistance and GKAP42 protein degradation in adipocytes. Additionally, it plays a role in angiogenesis, osteoclastogenesis, and IL12 production in dendritic cells. TNF-alpha/TNFSF2 Protein, Equine is the recombinant equine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with tag free.
Background
TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, predominantly secreted by macrophages and exhibiting diverse biological functions. It possesses the capability to induce cell death in specific tumor cell lines, serving as a potent pyrogen that can cause fever through direct action or by stimulating interleukin-1 secretion, and is implicated in the induction of cachexia. Under certain conditions, TNF-alpha/TNFSF2 can play a role in both stimulating cell proliferation and inducing cell differentiation. It also contributes to insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, with additional effects on GKAP42 protein degradation. Furthermore, TNF-alpha/TNFSF2 participates in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and promotes osteoclastogenesis, thereby mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, further highlighting its multifaceted impact on diverse cellular processes.
Verified Bioactivity
Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 122 pg/mL, corresponding to a specific activity is 8.20×106 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Equine
-
Source E. coli
-
Tag Tag Free
-
Accession
NP_001075288 (L78-L234)
-
Gene ID100033834 [NCBI]
-
Molecular Construction
-
N-term
-
TGF-α (L78-L234)
Accession # NP_001075288 -
C-term
-
-
Protein Length
Full Length of Tumor necrosis factor, soluble form Chain
-
Synonyms
TNF; Tumor Necrosis Factor (TNF Superfamily, Member 2); Prev. TNFA; Tumor Necrosis Factor-Alpha; TNF-Alpha; Tumor Necrotic Factor Alpha; TNFSF2; TNF Superfamily, Member 2; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF, Macrophage-Derived; TNF-A;
-
AA Sequence
LRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKLTDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHTESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL
-
Predicted Molecular Mass
17.1 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)