TNF-alpha/TNFSF2 Protein, Equine

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, fever, cachexia, cell proliferation, and cell differentiation. It also causes insulin resistance and GKAP42 protein degradation in adipocytes. Additionally, it plays a role in angiogenesis, osteoclastogenesis, and IL12 production in dendritic cells. TNF-alpha/TNFSF2 Protein, Equine is the recombinant equine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with tag free.

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, predominantly secreted by macrophages and exhibiting diverse biological functions. It possesses the capability to induce cell death in specific tumor cell lines, serving as a potent pyrogen that can cause fever through direct action or by stimulating interleukin-1 secretion, and is implicated in the induction of cachexia. Under certain conditions, TNF-alpha/TNFSF2 can play a role in both stimulating cell proliferation and inducing cell differentiation. It also contributes to insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, with additional effects on GKAP42 protein degradation. Furthermore, TNF-alpha/TNFSF2 participates in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and promotes osteoclastogenesis, thereby mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, further highlighting its multifaceted impact on diverse cellular processes.

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 122 pg/mL, corresponding to a specific activity is 8.20×10⁶ units/mg.

• 
  Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 122 pg/mL, corresponding to a specific activity is 8.20×10⁶ units/mg.

Equine

E. coli

Tag Free

NP_001075288 (L78-L234)

100033834  [NCBI]

Partial

LRSSSRTPSDKPVAHVVANPQAEGQLQWLSGRANALLANGVKLTDNQLVVPLDGLYLIYSQVLFKGQGCPSTHVLLTHTISRLAVSYPSKVNLLSAIKSPCHTESPEQAEAKPWYEPIYLGGVFQLEKGDQLSAEINQPNYLDFAESGQVYFGIIAL

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.