TRAIL/TNFSF10 Protein, Mouse (His)

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis. It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis. TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers. This complex molecular interaction governs apoptotic signaling pathways. TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived TRAIL/TNFSF10 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TRAIL/TNFSF10 Protein, Mouse (His) is 174 a.a., with molecular weight of ~21.82 kDa.

The TRAIL/TNFSF10 protein, a cytokine, binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly TNFRSF11B/OPG, inducing apoptosis. Its apoptotic activity may be modulated by binding to decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG, which lack the ability to induce apoptosis. TRAIL/TNFSF10 exists as a homotrimer, where one TRAIL/TNFSF10 homotrimer interacts with three TNFRSF10A monomers and another homotrimer interacts with three TNFRSF10B monomers. This multivalent interaction underscores the intricate molecular interactions governing the apoptotic signaling pathways mediated by TRAIL/TNFSF10 and its receptors.

Measured in a cytotoxicity assay using L929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 0.2378 ng/mL, corresponding to a specific activity is 4.205×10⁶ units/mg.

• 
  Measured in a cytotoxicity assay using L929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 0.2378 ng/mL, corresponding to a specific activity is 4.205×10⁶ units/mg.

Mouse

E. coli

N-6*His

P50592 (P118-N291)

22035

PRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Approximately 21.82 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.