Copy Link Print Information

TRAIL/TNFSF10 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived TRAIL/TNFSF10 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TRAIL/TNFSF10 Protein, Mouse (His)
  • Experimental Validation Results for TRAIL/TNFSF10 Protein, Mouse (His)
  • TRAIL/TNFSF10 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived TRAIL/TNFSF10 protein, expressed by E.coli , with N-6*His labeled tag.

Background

The TRAIL/TNFSF10 protein, a cytokine, binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly TNFRSF11B/OPG, inducing apoptosis. Its apoptotic activity may be modulated by binding to decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG, which lack the ability to induce apoptosis. TRAIL/TNFSF10 exists as a homotrimer, where one TRAIL/TNFSF10 homotrimer interacts with three TNFRSF10A monomers and another homotrimer interacts with three TNFRSF10B monomers. This multivalent interaction underscores the intricate molecular interactions governing the apoptotic signaling pathways mediated by TRAIL/TNFSF10 and its receptors.

Verified Bioactivity

Measured in a cytotoxicity assay using L929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.1-1.0 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession

    P50592 (P118-N291)

  • Gene ID
    22035
  • Molecular Construction
    • N-term
    • 6*His
    • TRAIL (P118-N291)
      Accession # P50592
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFSF10; APO2L; TNF Superfamily Member 10; Tumor Necrosis Factor (Ligand) Family, Member 10; Apo-2L; Tumor Necrosis Factor Ligand Superfamily Member; TRAIL; TNF-Related Apoptosis Inducing Ligand TRAIL; CD253; Tumor Necrosis Factor Superfamily Member 10; T

  • AA Sequence

    PRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

  • Predicted Molecular Mass

    20.9 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCL, 10 mM (NH4)2SO4, 0.1 mM ZnSO4, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cytotoxicity assay using L929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.2378 ng/mL, corresponding to a specific activity is 4.205×106 units/mg.

  • TRAIL/TNFSF10 Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for TRAIL/TNFSF10 Protein, Mouse (His)
  • Experimental Validation Results for TRAIL/TNFSF10 Protein, Mouse (His)
  • TRAIL/TNFSF10 Protein, Mouse (His) Product Image