TM4SF1 Protein,Human (N-His)

TM4SF1 protein-VLP is present in tumor cells and can form high molecular weight complexes, indicating its involvement in complex cellular processes in malignant tumors. It interacts with SDCBP2, emphasizing its association with specific molecular pathways, suggesting a role in cell signaling or regulatory mechanisms. TM4SF1 Protein,Human (N-His) is the recombinant human-derived TM4SF1 protein,Human, expressed by P. pastoris , with N-His labeled tag. The total length of TM4SF1 Protein,Human (N-His) is 47 a.a., with molecular weight of 7.3 kDa.

The TM4SF1 Protein-VLP, identified in tumor cells, is notably present in high molecular weight complexes, indicating its involvement in intricate cellular processes within these malignancies. Furthermore, the protein interacts with SDCBP2, emphasizing its association with specific molecular pathways and potential roles in cellular signaling or regulatory mechanisms. This insight into TM4SF1 Protein-VLP's molecular interactions and its presence in tumor cell complexes contributes to the understanding of its functional significance within the context of tumorigenesis.

Human

P. pastoris

N-His

P30408 (L115-S161)

4071

LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

7.3 kDa

Greater than 90% as determined by SDS-PAGE.

<1 EU/μg, determined by LAL method.