TREML1 Protein, Human (HEK293, His)
TREML1 (triggering receptor expressed on myeloid cells, like 1) is a cell surface receptor that may play a role in innate and adaptive immune responses. When phosphorylated, TREML1 interacts with the proteins PTPN6 and PTPN11, suggesting that it may be involved in regulating signaling pathways related to immune processes. TREML1 Protein, Human (HEK293, His) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TREML1 (triggering receptor expressed on myeloid cells, like 1) is a cell surface receptor that may play a role in innate and adaptive immune responses. When phosphorylated, TREML1 interacts with the proteins PTPN6 and PTPN11, suggesting that it may be involved in regulating signaling pathways related to immune processes. TREML1 Protein, Human (HEK293, His) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TREML1 (Triggering Receptor Expressed on Myeloid Cells Like 1) is a cell surface receptor that likely plays a role in both innate and adaptive immune responses. When phosphorylated, TREML1 interacts with proteins PTPN6 and PTPN11, indicating its potential involvement in regulating signaling pathways associated with immune processes. This suggests that TREML1 may have a significant impact on immune system function and could be a target for further investigation in understanding immune responses and developing therapeutic interventions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q86YW5 (Q16-P162)
-
Molecular Construction
-
N-term
-
TREML1 (Q16-P162)
Accession # Q86YW5 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TREML1; TLT-1; Triggering Receptor Expressed On Myeloid Cells Like 1; Triggering Receptor Expressed On Myeloid Cells-Like 1; TLT1; TREM-Like Transcript 1; DJ238O23.3; GLTL1825; Triggering Receptor Expressed On Myeloid Cells-Like Protein 1; PRO3438; Trem-L
-
AA Sequence
QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
