PRSS3/Trypsin-3 Protein, Human (His)
Based on 1 Customer Validation
PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.
PRSS3, also known as Trypsin-3, is a digestive protease with a distinct substrate specificity, as it cleaves proteins preferentially after an Arginine residue. This trypsin-like enzyme plays a crucial role in the digestive process by breaking down dietary proteins into smaller peptides. Notably, PRSS3 exhibits proteolytic activity towards Kunitz-type trypsin inhibitors, suggesting its involvement in regulatory interactions with endogenous protease inhibitors. The enzyme's ability to cleave proteins at specific sites underscores its importance in protein digestion, and its interactions with trypsin inhibitors highlight its role in the intricate balance of protease activity within cellular environments. Ongoing research may reveal further insights into the physiological implications and regulatory functions of PRSS3 in digestive physiology.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P35030-1 (I81-N303)
-
Molecular Construction
-
N-term
-
6*His
-
PRSS3 (I81-N303)
Accession # P35030-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PRSS3; Trypsin IV; Prev. PRSS4; Protease, Serine, 3 (Mesotrypsin); TRY3; Pancreatic Trypsinogen III; TRY4; Serine Protease 4; Mesotrypsin; Trypsinogen IV; Protease, Serine, 4 (Trypsin 4, Brain); Trypsinogen 4; Protease, Serine 3; Trypsinogen 5; Brain Tryp
-
AA Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN
-
Predicted Molecular Mass
28.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
