TSLP Protein, Cynomolgus (His)
Based on 1 Customer Validation
Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and promotes T helper type 2 (TH2) cell responses associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. TSLP Protein, Cynomolgus (His) is the recombinant cynomolgus-derived TSLP protein, expressed by E. coli , with C-6*His labeled tag and Q37E mutation.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and promotes T helper type 2 (TH2) cell responses associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. TSLP Protein, Cynomolgus (His) is the recombinant cynomolgus-derived TSLP protein, expressed by E. coli , with C-6*His labeled tag and Q37E mutation.
Background
Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. TSLP promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease, therefore TSLP is considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of TSLP gene results in multiple isoforms, the shorter (predominant) isoform is an antimicrobial protein, displaying antibacterial and antifungal activity against B. cereus, E. coli, E. faecalis, S. mitis, S. epidermidis, and C. albicans[1][2][3][4].
Verified Bioactivity
Immobilized Anti-Human TSLP mAb at 2 μg/mL (100 μL/well) can bind Cynomolgus TSLP-His. The ED50 of Cynomolgus TSLP-His is 1.0-30.0 ng/mL.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag C-6*His
-
Accession
XP_005557555.1 (Y29-Q159, Q37E)
-
Molecular Construction
-
N-term
-
TSLP (Y29-Q159, Q37E)
Accession # XP_005557555.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP
-
AA Sequence
YDFTNCDFEKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
-
Predicted Molecular Mass
16.2 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 6% trehalose, 2% glycine, 50 mM NaCl, 0.05% Tween 80, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
