TWSG1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.
Background
TWSG1 protein is potentially involved in the formation of the dorsoventral axis. It appears to exert its function by counteracting BMP signaling through the formation of ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors. Interestingly, TWSG1 exhibits both anti-BMP and pro-BMP activities. It achieves the latter by cleaving and degrading CHRD, leading to the release of BMPs from the ternary complexes. This dual role suggests that TWSG1 may be a crucial regulator of BMP-mediated processes, particularly in cartilage development and chondrocyte differentiation. Additionally, it may also play a role in thymocyte development. TWSG1 interacts with CHRD and/or BMP4, enhancing the formation of CHRD/BMP4 complexes, and it also interacts with BMP7. Further investigations are needed to fully comprehend the precise mechanisms and signaling pathways through which TWSG1 operates.
Verified Bioactivity
Measured by its ability to inhibit BMP-6-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.8289 µg/mL in the presence of 150 ng/mL of Recombinant Human BMP-6, corresponding to a specific activity is 1.206×103 U/mg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9EP52 (C25-F222)
-
Molecular Construction
-
N-term
-
TWSG1 (C25-F222)
Accession # Q9EP52 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TWSG1; TSG; PSEC0250; Twisted gastrulation protein homolog 1; Twisted Gastrulation Homolog 1; Twisted Gastrulation Homolog 1 (Drosophila) ; Twisted Gastrulation Protein Homolog 1;
-
AA Sequence
CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
-
Predicted Molecular Mass
22.2 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
