U12 Protein, HHV-6 variant A (Cell-Free, His)

The U12 protein is a potential G protein-coupled receptor, suggesting a role in cell signaling. Its classification suggests involvement in signal transduction, suggesting importance in mediating a variety of cellular processes. U12 Protein, HHV-6 variant A (Cell-Free, His) is the recombinant Virus-derived U12 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of U12 Protein, HHV-6 variant A (Cell-Free, His) is 347 a.a., with molecular weight of 42.6 kDa.

The U12 protein emerges as a probable G-protein coupled receptor, hinting at its potential role in cellular signaling and responses. The designation as a G-protein coupled receptor suggests that U12 is likely involved in transducing signals across the cell membrane, pointing towards its significance in mediating various cellular processes. The precise ligands and downstream signaling pathways associated with U12 remain to be elucidated, but its classification as a G-protein coupled receptor implies a capacity for diverse regulatory functions within the cellular milieu. Further exploration of U12's functional properties and interactions will provide valuable insights into its role in cellular signaling and potential contributions to physiological processes.

Virus

E. coli Cell-free

N-10*His

P52380 (M1-L347)

/

MDTVIELSKLQFKGNASCTSTPTLKTARIMESAVTGITLTTSIPMIIIVVTTMILYHRVAKHNATSFYVITLFASDFVLMWCVFFMTVNRKQLFSFNRFFCQLVYFIYHAVCSYSISMLAIIATIRYKTLHRRKKTESKTSSTGRNIGILLLASSMCAIPTALFVKTNGMKKTGKCVVYISSKKAYELFLAVKIVFSFIWGVLPTMVFSFFYVIFCKALHDVTEKKYKKTLFFIRILLLSFLLIQIPYIAILICEIAFLYMPQNTCFWLARVEILQLIIRLMPQVHCFSNPLVYAFTGGELRNRFTACFQSFFPKTLCSTQKRKDSDASEHDQNSKSKASVEKNQPL

42.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.