U24 Protein, HHV-6 variant B (Cell-Free, His)

U24 protein plays a crucial role in the regulation of host T cell function by downregulating the TCR/CD3E complex and transferrin receptor TFRC, preventing their recycling to the cell surface. This regulatory mechanism contributes to the complex manipulation of host cell processes by viral proteins. U24 Protein, HHV-6 variant B (Cell-Free, His) is the recombinant Virus-derived U24 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of U24 Protein, HHV-6 variant B (Cell-Free, His) is 88 a.a., with molecular weight of 16.2 kDa.

The U24 protein, identified for its pivotal role in immune evasion, exerts regulatory control over host T-cells by down-regulating the TCR/CD3E complex and the transferrin receptor TFRC. This inhibition is achieved by impeding their recycling to the cell surface. U24 further engages with host ITCH, likely facilitating the degradation of ITCH, thus implicating its involvement in immune response modulation. Additionally, the protein is presumed to interact with NEDD4, underscoring its multifaceted interactions with key cellular components. These findings underscore the intricate mechanisms employed by U24 to subvert the host immune system, emphasizing its significance in viral immune evasion strategies.

Virus

E. coli Cell-free

N-10*His

Q9QJ42 (M1-K88)

1497025

MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK

16.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.