ZWINT/ZW10 interactor Protein, Human (GST)
ZWINT, a vital MIS12 complex component, is essential for kinetochore and spindle checkpoint activity. It plays a pivotal role in ZW10 targeting to the kinetochore in prometaphase, forming interactions with ZW10, MIS12, and NDC80 subunit of the NDC80 complex. ZWINT's engagement with KNL1, CETN3, DSN1, and PMF1 underscores its multifaceted role in orchestrating kinetochore complex assembly and functionality during mitosis. ZWINT/ZW10 interactor Protein, Human (GST) is the recombinant human-derived ZWINT/ZW10 interactor protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ZWINT, a vital MIS12 complex component, is essential for kinetochore and spindle checkpoint activity. It plays a pivotal role in ZW10 targeting to the kinetochore in prometaphase, forming interactions with ZW10, MIS12, and NDC80 subunit of the NDC80 complex. ZWINT's engagement with KNL1, CETN3, DSN1, and PMF1 underscores its multifaceted role in orchestrating kinetochore complex assembly and functionality during mitosis. ZWINT/ZW10 interactor Protein, Human (GST) is the recombinant human-derived ZWINT/ZW10 interactor protein, expressed by E. coli , with N-GST labeled tag.
Background
ZWINT, as a key component of the MIS12 complex, plays a pivotal role in kinetochore formation and spindle checkpoint activity. Its involvement is crucial for the proper targeting of ZW10 to the kinetochore during prometaphase. ZWINT establishes interactions with essential partners within the complex, including ZW10 and MIS12. Furthermore, ZWINT exhibits a specific interaction with the NDC80 subunit of the NDC80 complex during mitosis, contributing to the orchestration of intricate cellular processes associated with spindle dynamics. In addition to these interactions, ZWINT engages with KNL1, CETN3, DSN1, and PMF1, highlighting its multifaceted role in facilitating the assembly and functionality of the kinetochore complex.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O95229-1 (M1-P277)
-
Molecular Construction
-
N-term
-
GST
-
ZWINT (M1-P277)
Accession # O95229-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ZWINT; Zwint-1; ZW10 Interacting Kinetochore Protein; CDNA FLJ36489 Fis, Clone THYMU2018126, Highly Similar To ZW10 Interactor; KNTC2AP; CDNA FLJ60420, Highly Similar To ZW10 Interactor; Zwint1; ZW10 Interactor, Kinetochore Protein; SIP30; Human ZW10 Inte
-
AA Sequence
SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL
-
Predicted Molecular Mass
58.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
