1. GPCR/G Protein
  2. GLP Receptor
  3. Albiglutide

Albiglutide 

Cat. No.: HY-108795
Handling Instructions

Albiglutide, a glucagon-like peptide-1 (GLP-1) mimetic, is a long-acting GLP-1 receptor agonist. Albiglutide significantly reduces glycosylated hemoglobin (A1C). Albiglutide can be used for type 2 diabetes (T2D) research. Albiglutide is generated by the genetic fusion of a DPP-4-resistant GLP-1 dimer to human albumin.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Albiglutide Chemical Structure

Albiglutide Chemical Structure

CAS No. : 782500-75-8

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other In-stock Forms of Albiglutide:

Other Forms of Albiglutide:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Albiglutide, a glucagon-like peptide-1 (GLP-1) mimetic, is a long-acting GLP-1 receptor agonist. Albiglutide significantly reduces glycosylated hemoglobin (A1C). Albiglutide can be used for type 2 diabetes (T2D) research. Albiglutide is generated by the genetic fusion of a DPP-4-resistant GLP-1 dimer to human albumin[1][2][3].

Molecular Weight

3283.60

Formula

C148H224N40O45

CAS No.
Sequence

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Sequence Shortening

HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Albiglutide
Cat. No.:
HY-108795
Quantity:
MCE Japan Authorized Agent: