1. Recombinant Proteins
  2. Complement System
  3. Complement Component 3
  4. Complement Component 3a
  5. Complement C3/C3a Protein, Human

Complement C3/C3a Protein, Human

Cat. No.: HY-P7862
COA Handling Instructions

Complement C3/C3a proteins play a key role in initiating the complement system through processing by C3 convertase in the classical and alternative pathways. Upon activation, C3b covalently binds to the surface, while C3a (anaphylatoxin produced by proteolysis of C3) mediates local inflammation. Complement C3/C3a Protein, Human is the recombinant human-derived Complement C3/C3a protein, expressed by E. coli , with tag free. The total length of Complement C3/C3a Protein, Human is 77 a.a., with molecular weight of ~13.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $52 In-stock
10 μg $89 In-stock
50 μg $250 In-stock
100 μg $425 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement C3/C3a proteins play a key role in initiating the complement system through processing by C3 convertase in the classical and alternative pathways. Upon activation, C3b covalently binds to the surface, while C3a (anaphylatoxin produced by proteolysis of C3) mediates local inflammation. Complement C3/C3a Protein, Human is the recombinant human-derived Complement C3/C3a protein, expressed by E. coli , with tag free. The total length of Complement C3/C3a Protein, Human is 77 a.a., with molecular weight of ~13.0 kDa.

Background

C3 assumes a pivotal role in the initiation of the complement system, and its processing by C3 convertase constitutes a central reaction in both classical and alternative complement pathways. Following activation, C3b has the capacity to covalently bind to cell surface carbohydrates or immune aggregates through its reactive thioester. Concurrently, the anaphylatoxin C3a, derived from the proteolytic degradation of complement C3, serves as a mediator in local inflammatory processes. In instances of chronic inflammation, C3a acts as a chemoattractant for neutrophils, inducing smooth muscle contraction, increasing vascular permeability, and triggering histamine release from mast cells and basophilic leukocytes.

Biological Activity

Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is ≤0.4476 μg/mL, corresponding to a specific activity is ≥2234.1376 U/mg.

  • Measured by its ability to enhance IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.1759 μg/mL, corresponding to a specific activity is 5685.0483 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01024 (S672-R748)

Gene ID

718  [NCBI]

Molecular Construction
N-term
C3a (S672-R748)
Accession # P01024
C-term
Synonyms
rHuComplement C3/C3a; Complement Component C3a; C3a; Anaphylatoxin
AA Sequence

SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Molecular Weight

Approximately 13.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Complement C3/C3a Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement C3/C3a Protein, Human
Cat. No.:
HY-P7862
Quantity:
MCE Japan Authorized Agent: