S100B Protein, Human (His)

The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100B Protein, Human (His) is 92 a.a., with molecular weight of ~12.0 kDa.

S100B is a protein that plays a role in binding calcium and zinc ions. It has distinct binding sites for each ion on each monomer. Physiological concentrations of potassium ions can interfere with the binding of both calcium and zinc, particularly affecting the high-affinity calcium-binding sites. S100B functions as a neurotrophic factor, promoting astrocytosis and axonal proliferation. It is also involved in the innervation of thermogenic adipose tissue, promoting sympathetic innervation. S100B can activate the STK38 kinase by releasing inhibitory interactions within the kinase. After a myocardial infarction, it interacts with AGER, potentially contributing to myocyte apoptosis through ERK1/2 and p53/TP53 signaling. S100B may assist in the cytoplasmic processing of ATAD3A, preventing aggregation and facilitating mitochondrial localization. It can also modulate the activity of other proteins, such as TPR-containing proteins, through calcium-dependent interactions. S100B forms dimers of either two alpha chains, two beta chains, or one alpha and one beta chain. It interacts with various proteins, including CACYBP, ATAD3A, S100A6, CAPZA1, AGER, PPP5C, TPPP, and isoform CLSTN3beta of CLSTN3, with different functional consequences.

Measured in a cell proliferation assay using THP-1 cells. The ED₅₀ for this effect is 0.09308 μg/mL, corresponding to a specific activity is 1.07×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using THP-1 cells. The ED₅₀ for this effect is 0.09308 μg/mL, corresponding to a specific activity is 1.07×10⁴ units/mg.

Human

E. coli

N-6*His

P04271 (M1-E92)

6285  [NCBI]

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Approximately 12.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.