Gastric Inhibitory Peptide, porcine
Based on 1 Customer Validation
Gastric Inhibitory Peptide (GIP (1-42)), porcine is a porcine glucose-dependent insulinotropic polypeptide and inhibitor of pentagastrin-stimulated gastric acid secretion. Gastric Inhibitory Peptide, porcine stimulates endogenous somatostatin release. Gastric Inhibitory Peptide, porcine acts in a dose- and time-dependent manner in conscious, chronic gastric fistula-equipped rats.
For research use only. We do not sell to patients.
- Purity : 99.12%
- CAS No.: 11063-17-5
- Formula: C225H342N60O66S
- Molecular Weight:4975.55
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
![[D-Ala2]-GIP (human)](https://file.medchemexpress.com/product_pic/hy-p3247.gif)
Biological Activity
Description
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:CD rats (adult male, 300-400 g, chronic gastric fistula model)[1]
-
Dosage:10 nmol/kg/h
-
Administration:i.v.; continuous infusion until end of experiment
-
Result:Inhibited pentagastrin-stimulated gastric acid secretion in a dose- and time-dependent manner.
Achieved an IC50 of 0.96 nmol /kg/h.
Reduced pentagastrin-stimulated gastric acid output to 33.8 μmol/30 min, corresponding to 109.3% inhibition relative to pentagastrin-only controls.
Chemical Information
-
CAS No. 11063-17-5
-
Appearance Solid
-
Molecular Weight 4975.55
-
Formula C225H342N60O66S
-
Color White to light yellow
-
Synonyms
GIP (1-42), porcine
-
Sequence Shortening
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
In Vitro:
H2O : ≥ 33.33 mg/mL (6.70 mM)
DMSO : 5 mg/mL (1.00 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (276 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 5 mM | 0.0402 mL | 0.2010 mL | 0.4020 mL | 1.0049 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Gastric Inhibitory Peptide, porcine Related Classifications
HY-P3579 Related Classifications
Powered by Bioz
Keywords