2. Protein Tyrosine Kinase/RTK
  3. Insulin Receptor
  4. Gastric Inhibitory Peptide, porcine

Gastric Inhibitory Peptide, porcine  (Synonyms: GIP (1-42), porcine)

Cat. No.: HY-P3579 Pureté: 99.12%
COA
SDS
Instruction de manipulation Technical Support

Gastric Inhibitory Peptide (GIP (1-42)), porcine is a porcine glucose-dependent insulinotropic polypeptide and inhibitor of pentagastrin-stimulated gastric acid secretion. Gastric Inhibitory Peptide, porcine stimulates endogenous somatostatin release. Gastric Inhibitory Peptide, porcine acts in a dose- and time-dependent manner in conscious, chronic gastric fistula-equipped rats.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

Gastric Inhibitory Peptide, porcine

Gastric Inhibitory Peptide, porcine Chemical Structure

CAS No. : 11063-17-5

Size Prix Stock Quantité
1 mg En stock
5 mg En stock
10 mg En stock
50 mg   Obtenir un devis  
100 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 1 Customer Validation

Gastric Inhibitory Peptide, porcine Related Antibodies

Top Publications Citing Use of Products

  • Activité biologique

  • Pureté et documentation

  • Références

  • Avis client

Description

Gastric Inhibitory Peptide (GIP (1-42)), porcine is a porcine glucose-dependent insulinotropic polypeptide and inhibitor of pentagastrin-stimulated gastric acid secretion. Gastric Inhibitory Peptide, porcine stimulates endogenous somatostatin release. Gastric Inhibitory Peptide, porcine acts in a dose- and time-dependent manner in conscious, chronic gastric fistula-equipped rats[1].

In Vivo

Porcine GIP-(1-42) (10 nmol/kg/h; i.v.; continuous infusion until end of experiment) exerts potent, dose-dependent inhibition of Pentagastrin (HY-A0261)-stimulated gastric acid secretion in conscious rats, with an IC50 of 0.96 nmol/kg/h and 109.3% inhibition at a dose of 10 nmol/kg/h[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: CD rats (adult male, 300-400 g, chronic gastric fistula model)[1]
Dosage: 10 nmol/kg/h
Administration: i.v.; continuous infusion until end of experiment
Result: Inhibited pentagastrin-stimulated gastric acid secretion in a dose- and time-dependent manner.
Achieved an IC50 of 0.96 nmol /kg/h.
Reduced pentagastrin-stimulated gastric acid output to 33.8 μmol/30 min, corresponding to 109.3% inhibition relative to pentagastrin-only controls.
Masse moléculaire

4975.55

Formule

C225H342N60O66S
CAS No.
Appearance

Solid

Color

White to light yellow

Sequence Shortening

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvant et solubilité
In Vitro: 

H2O : ≥ 33.33 mg/mL (6.70 mM)

DMSO : 5 mg/mL (1.00 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2010 mL 1.0049 mL 2.0098 mL
5 mM 0.0402 mL 0.2010 mL 0.4020 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureté et documentation

Purity: 99.12%

SDS (252 KB)

COA (252 KB) RP-HPLC (255 KB) MS (73 KB)

Instruction de manipulation (2659 KB)
Références

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 5 mM 0.0402 mL 0.2010 mL 0.4020 mL 1.0049 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Gastric Inhibitory Peptide, porcine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Gastric Inhibitory Peptide, porcine11063-17-5GIP (1-42), porcineInsulin ReceptorCHO-K1 cellsporcine glucose-dependent insulinotropic polypeptideGastric Inhibitory Peptidesomatostatinpentagastrin-stimulated gastric acid secretionconsciouschronic gastric fistula-equipped ratsInhibitorinhibitorinhibit

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Gastric Inhibitory Peptide, porcine
Cat. No.:
HY-P3579
Quantité:
MCE Japan Authorized Agent:

Avis client

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Adresse e-mail *

Numéro de téléphone

 

Department *

Nom de l'organisation *

 

Country or Region *

Remarques

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.