[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate
Based on 1 Customer Validation
[K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is the acetate of [K15,R16,L27]VIP(1-7)/GRF(8-27) (HY-P4195). [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively. VIP: VASOACTIVE Intestinal Polypeptide
For research use only. We do not sell to patients.
- Purity : 99.50%
- Formula: C142H240N44O38.xC2H4O2
- Molecular Weight:3171.70 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
![[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate Chemical Structure](https://file.medchemexpress.com/product_pic/hy-p4195a.gif "Click to View [K15,R16,L27]VIP(1-7)/GRF(8-27) acetate Chemical Structure")
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
IC50 & Target
VIP1[1]
Chemical Information
-
Appearance Solid
-
Molecular Weight 3171.70 (free base)
-
Formula C142H240N44O38.xC2H4O2
-
Color White to off-white
-
Sequence
His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2
-
Sequence Shortening
HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 16.67 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 10 mg/mL (Need ultrasonic)
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Purity & Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate Related Classifications
HY-P4195A Related Classifications
Powered by Bioz