[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate
Based on 1 Customer Validation
[K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is the acetate of [K15,R16,L27]VIP(1-7)/GRF(8-27) (HY-P4195). [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively. VIP: VASOACTIVE Intestinal Polypeptide
For research use only. We do not sell to patients.
- Purity : 99.50%
- Formula: C142H240N44O38.xC2H4O2
- Molecular Weight:3171.70 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
IC50 & Target
VIP1[1]
Chemical Information
-
Appearance Solid
-
Molecular Weight 3171.70 (free base)
-
Formula C142H240N44O38.xC2H4O2
-
Color White to off-white
-
Sequence
His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2
-
Sequence Shortening
HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 16.67 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 10 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)